(data stored in ACNUC9543 zone)

EMBL: AL844507.PE236

AL844507.PE236       Location/Qualifiers
FT   CDS             complement(1049282..1051705)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0824000"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0824000"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0030:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB74"
FT                   /protein_id="CAD51133.1"
FT                   /translation="MNETSYIPGYRDINVQAFYRPQEDYAFANNIRAKQFIYNPYFKKE
FT                   LKGPYIKKMYEPFEMNKPHIKTIFSPHILSHTKLNRQCNPLVSYPYGIPRDIEYEKCPK
FT                   CKGKKKEHTIKYNKKEKKNINKIDTFSYEDNFFVSRLKPEYNNSTEEPHINIEKNNDND
FT                   NVINMDIYDIENIKDKSKRESYEDTYSIPMGNENIHDYSHSSTNSYDVIKELNKPRYEN
FT                   LDNFPMQYINTHDNDDSSMYYYSYNEKENFNSQEKIKKKNLDLKDLHINDEINIPNKYK
FT                   NDQKYKHNEVEESSSSLNSDEKYEIDNIISKYNNNNDIQKDNKKKMNLIDNNIINTDKK
FT                   GKKDLLIMLINDLTHGKIKHKKEKNDEKYQMNHENKIKRENMIKNENVVKNEEILKNTQ
FT                   QNLKQVKICENENIFSKYNVMEIYKNQNSISTDNIKEKNTSKQNAHHMKEHEKKKEMEV
FT                   EHYHRYCKSGNGKNGKNEKNEKEKKHEDTKIKRVYYKNSFELPKSNEQDMYQSNLSKKK
FT                   SFNPKKNKKVSIEKEPIVFKKSKDDQSKIAKQIIARAKSMKMKRIGTINFPTKNSNNIS
FT                   LKKRNTLKKLNTMVESKFKKQNTIVLKKRKTMPRLHLTKPPNPIIFINKKKFLKAQKTV
FT                   HIHDNNKKNKNNNTNNNNNNNNNNNNNNNKKILSRSKTKVYINNKSKIFKKAEVKMVSK
FT                   NPFNILASNNSSKTNIQDEKDKNTIKKDYVVNNNKNLNIPSKKDKPQINNHSVRNKLKS
FT                   KKDELYQNILSLTKNMKEQPLKKTYHEHINHKDLLSLTSKNSDEIYDNSVDGVL"
     MNETSYIPGY RDINVQAFYR PQEDYAFANN IRAKQFIYNP YFKKELKGPY IKKMYEPFEM        60
     NKPHIKTIFS PHILSHTKLN RQCNPLVSYP YGIPRDIEYE KCPKCKGKKK EHTIKYNKKE       120
     KKNINKIDTF SYEDNFFVSR LKPEYNNSTE EPHINIEKNN DNDNVINMDI YDIENIKDKS       180
     KRESYEDTYS IPMGNENIHD YSHSSTNSYD VIKELNKPRY ENLDNFPMQY INTHDNDDSS       240
     MYYYSYNEKE NFNSQEKIKK KNLDLKDLHI NDEINIPNKY KNDQKYKHNE VEESSSSLNS       300
     DEKYEIDNII SKYNNNNDIQ KDNKKKMNLI DNNIINTDKK GKKDLLIMLI NDLTHGKIKH       360
     KKEKNDEKYQ MNHENKIKRE NMIKNENVVK NEEILKNTQQ NLKQVKICEN ENIFSKYNVM       420
     EIYKNQNSIS TDNIKEKNTS KQNAHHMKEH EKKKEMEVEH YHRYCKSGNG KNGKNEKNEK       480
     EKKHEDTKIK RVYYKNSFEL PKSNEQDMYQ SNLSKKKSFN PKKNKKVSIE KEPIVFKKSK       540
     DDQSKIAKQI IARAKSMKMK RIGTINFPTK NSNNISLKKR NTLKKLNTMV ESKFKKQNTI       600
     VLKKRKTMPR LHLTKPPNPI IFINKKKFLK AQKTVHIHDN NKKNKNNNTN NNNNNNNNNN       660
     NNNNKKILSR SKTKVYINNK SKIFKKAEVK MVSKNPFNIL ASNNSSKTNI QDEKDKNTIK       720
     KDYVVNNNKN LNIPSKKDKP QINNHSVRNK LKSKKDELYQ NILSLTKNMK EQPLKKTYHE       780
     HINHKDLLSL TSKNSDEIYD NSVDGVL                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page