(data stored in ACNUC9543 zone)

EMBL: AL844507.PE238

AL844507.PE238       Location/Qualifiers
FT   CDS             join(1055135..1055161,1055437..1058553,1058773..1059003)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0824200"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0824200"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.34:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4X4"
FT                   /protein_id="CAX64152.1"
FT                   /translation="MSSAKSYKWYLENGCEIVPLKRACNRDYDYSLTVLDIQADFSEFL
FT                   VEENNIISNDKIVKADESIFNIQKKQFLHKDMNILEREKYVYEIDHLWAYIEWHYNFED
FT                   EIRLQRNLVSNINKLKKVPKLYVSAHIIEGVINEMSKNENICILKYTTFSSFYEKYKNE
FT                   LDNIKMKNKNSIYNVCNYIYEVCDIADKSLLFATSPIINTTMKNVLSITKSGKKREDFN
FT                   EEAEKEIITEDEIWQIYLSKKIKCINDQWLLICINQELKKIIKESGDLYFKMFNRYIKE
FT                   YNDFIKSHEYNTSEKNNDMNNMNIKNNNVSKNDSNNINRKSNIFLKGTQKNIFEVNHIN
FT                   HQLNNEKLKKYKVNLIFSENKDINYILYKLCLNLGKFNDAVLCTKNKTYNILMNDIDGT
FT                   LAICLQSFVSKYYRNNSMDNSDNMASNSTASCSVNDNYNAISTTNFSDDMDELIKNLSI
FT                   MGLCKEKIVLTEKATLFNNIELLYSYYLIVQNEALDNDDAKSGLNIQNNVDNNENNYDN
FT                   NENNYDNNENHYDNNDDGIIYFSKKALFENLQFSNEEISSYLLHLQKYSTNNLIYIENK
FT                   GFRYIKSEIIYEFIVKLIELISINDELYENQYVQRSHMENCAFSKYQEDLYKNVRKRYG
FT                   ISFTNLMSIIYENMHEFEFLNKNKIPIEKYVILQLCWKCCDIENNHFEYFNIYYNYYFF
FT                   YEYLNKSSNELSFENIFEEYLEFLKNDIYIDETIIYFNLFKLHNIMSLNILRSSGQVVI
FT                   HSDKLFTFDMDIFTYIKYIDDNFKNFNSSLMDKIIQTFIKSYQFFLDFGYDKNGTNEKN
FT                   NMHNNNNNNNNNNNSNNNNNNNNNNNNNNNNNNNNNGDGSLIDNELINTDIYKDRVLFR
FT                   NNILLNVNNINHICNDNYMFEYFIVVKYYYSDNSFALLEKKLKKFIKTTEDEFMQTYEN
FT                   STDKYDMHTKFKSNWDNIKSNYCLNYKIFKYQTTSFPHIRLNNNYNDLLNLVYTPLSLH
FT                   CSIFRENVIYNKKRNTFQLIPSFLLKNNLRSCLTALFTFKNSYYAQEFYPFLNPLLNNK
FT                   DLIGTIAVPPLRHCRTMLVEKENENNVEFIETKNIVLSTLNNDIKNYKMGTENNNKIVE
FT                   KLCKLYNCNLPVNNFST"
     MSSAKSYKWY LENGCEIVPL KRACNRDYDY SLTVLDIQAD FSEFLVEENN IISNDKIVKA        60
     DESIFNIQKK QFLHKDMNIL EREKYVYEID HLWAYIEWHY NFEDEIRLQR NLVSNINKLK       120
     KVPKLYVSAH IIEGVINEMS KNENICILKY TTFSSFYEKY KNELDNIKMK NKNSIYNVCN       180
     YIYEVCDIAD KSLLFATSPI INTTMKNVLS ITKSGKKRED FNEEAEKEII TEDEIWQIYL       240
     SKKIKCINDQ WLLICINQEL KKIIKESGDL YFKMFNRYIK EYNDFIKSHE YNTSEKNNDM       300
     NNMNIKNNNV SKNDSNNINR KSNIFLKGTQ KNIFEVNHIN HQLNNEKLKK YKVNLIFSEN       360
     KDINYILYKL CLNLGKFNDA VLCTKNKTYN ILMNDIDGTL AICLQSFVSK YYRNNSMDNS       420
     DNMASNSTAS CSVNDNYNAI STTNFSDDMD ELIKNLSIMG LCKEKIVLTE KATLFNNIEL       480
     LYSYYLIVQN EALDNDDAKS GLNIQNNVDN NENNYDNNEN NYDNNENHYD NNDDGIIYFS       540
     KKALFENLQF SNEEISSYLL HLQKYSTNNL IYIENKGFRY IKSEIIYEFI VKLIELISIN       600
     DELYENQYVQ RSHMENCAFS KYQEDLYKNV RKRYGISFTN LMSIIYENMH EFEFLNKNKI       660
     PIEKYVILQL CWKCCDIENN HFEYFNIYYN YYFFYEYLNK SSNELSFENI FEEYLEFLKN       720
     DIYIDETIIY FNLFKLHNIM SLNILRSSGQ VVIHSDKLFT FDMDIFTYIK YIDDNFKNFN       780
     SSLMDKIIQT FIKSYQFFLD FGYDKNGTNE KNNMHNNNNN NNNNNNSNNN NNNNNNNNNN       840
     NNNNNNNNGD GSLIDNELIN TDIYKDRVLF RNNILLNVNN INHICNDNYM FEYFIVVKYY       900
     YSDNSFALLE KKLKKFIKTT EDEFMQTYEN STDKYDMHTK FKSNWDNIKS NYCLNYKIFK       960
     YQTTSFPHIR LNNNYNDLLN LVYTPLSLHC SIFRENVIYN KKRNTFQLIP SFLLKNNLRS      1020
     CLTALFTFKN SYYAQEFYPF LNPLLNNKDL IGTIAVPPLR HCRTMLVEKE NENNVEFIET      1080
     KNIVLSTLNN DIKNYKMGTE NNNKIVEKLC KLYNCNLPVN NFST                       1124
//

If you have problems or comments...

PBIL Back to PBIL home page