(data stored in ACNUC9543 zone)

EMBL: AL844507.PE241

AL844507.PE241       Location/Qualifiers
FT   CDS             join(1066154..1066504,1066702..1067472)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0824500"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0824500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0029:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB79"
FT                   /protein_id="CAD51128.1"
FT                   /translation="MIKRYLKIYPSIYFTKHVYTAPEIDGSKDLLKKDYVFNQYVNKKE
FT                   IFLNNKLKKGNCENEIKRIYYFKLWNAMVEHNFTLFENIIQQYLNEGYKYDEVIYSIMT
FT                   HAYILNHKKKNENAYLVIEEMKRAFMHPIIIKINERMINCFLELELIFCEPSKSLWINV
FT                   CRFIWESSIKLNRERRRKLKEKLNLLEPNQVLKLTKEDVKKLVKKEYEETLLSMMDTLS
FT                   LDGEDPYDHILIDRKENYMKIENQKDGNFFPSNGNELTCLNNNHIYNDHINYLKGNIEN
FT                   DTSENVNSFMFSILNEGKNKTTEQEINYQDDYNLNNNDYMTKITNINSDNNIMMNMENE
FT                   HMYETDEKDEHYESFDDAEDFDIQLLKKYYNLK"
     MIKRYLKIYP SIYFTKHVYT APEIDGSKDL LKKDYVFNQY VNKKEIFLNN KLKKGNCENE        60
     IKRIYYFKLW NAMVEHNFTL FENIIQQYLN EGYKYDEVIY SIMTHAYILN HKKKNENAYL       120
     VIEEMKRAFM HPIIIKINER MINCFLELEL IFCEPSKSLW INVCRFIWES SIKLNRERRR       180
     KLKEKLNLLE PNQVLKLTKE DVKKLVKKEY EETLLSMMDT LSLDGEDPYD HILIDRKENY       240
     MKIENQKDGN FFPSNGNELT CLNNNHIYND HINYLKGNIE NDTSENVNSF MFSILNEGKN       300
     KTTEQEINYQ DDYNLNNNDY MTKITNINSD NNIMMNMENE HMYETDEKDE HYESFDDAED       360
     FDIQLLKKYY NLK                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page