(data stored in ACNUC9543 zone)

EMBL: AL844507.PE242

AL844507.PE242       Location/Qualifiers
FT   CDS             join(1068563..1069027,1069183..1069410,1069572..1069617,
FT                   1069724..1069770,1069888..1069902)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0824600"
FT                   /product="Fe-S cluster assembly protein DRE2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0824600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.31:mRNA"
FT                   /db_xref="GOA:C0H4X5"
FT                   /db_xref="InterPro:IPR007785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H4X5"
FT                   /protein_id="CAX64153.1"
FT                   /translation="MIINFVGNTLIIFNEDIPCDLLRKKYKELFVPTISVLDFKKKRLY
FT                   RKYNNIFLYTYKNYSFLWELENNILHKVQKCLNKNGILKLIIYLNKNDVITPDKHENKN
FT                   NNDIKVNIDQKDYCENYINDIFKNIKKECLYNGFINIVNETSVAENGIILNITAENPDF
FT                   LSNEDNDVSSDDEDLYNNEDDKKKVVNRVCDNCTCGKKEKLLNSENKVLINEKDGEYIT
FT                   ENVVSSCGNCYLGDAFRCASCPYKGLPAFQPGENVKLNLNNESN"
     MIINFVGNTL IIFNEDIPCD LLRKKYKELF VPTISVLDFK KKRLYRKYNN IFLYTYKNYS        60
     FLWELENNIL HKVQKCLNKN GILKLIIYLN KNDVITPDKH ENKNNNDIKV NIDQKDYCEN       120
     YINDIFKNIK KECLYNGFIN IVNETSVAEN GIILNITAEN PDFLSNEDND VSSDDEDLYN       180
     NEDDKKKVVN RVCDNCTCGK KEKLLNSENK VLINEKDGEY ITENVVSSCG NCYLGDAFRC       240
     ASCPYKGLPA FQPGENVKLN LNNESN                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page