(data stored in ACNUC9543 zone)

EMBL: AL844507.PE244

AL844507.PE244       Location/Qualifiers
FT   CDS             1075800..1079630
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0824800"
FT                   /product="conserved Plasmodium membrane protein, unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0824800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0028:mRNA"
FT                   /db_xref="GOA:Q8IB82"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB82"
FT                   /protein_id="CAD51125.1"
FT                   /translation="MMNKFYYSFKNKENENDATDKIKENIFMKDNNNYDYNENSYDKNS
FT                   MYDDNKIIRKRSRKKKGEQDENMASKNIERKSSFNSFHLDNENVNKDYYYENYDMDDNK
FT                   YDKNGNVNYDNYNKNDDLLYNKNDDMLYNKNDDIYNNKNKNDSSNYNNGNSLINPEFIK
FT                   NIGICYNIINDETKFENDTCFKKISDIIELRITQIIEEANKFYEKRKRYTINKYLSIED
FT                   LTNCCNYLNVVIPYKYKNSFFYNFITLNENYKNNKIIYRLISKKEYPDYLKKRHSRKTY
FT                   EKRKKKLYHMQMKKEKIKNMQNKNVKEKNINKKHNKYNKHNKLNKYTKKNKHKFKHSSK
FT                   HMFKMIHNNFIGNEKKGTNNRTNLYNESYHTKKHKNKYTTHKNKINKHSKKNKKEHIKK
FT                   DTEVDQINNKESDITNHDKFNMFSENEKHDSPKEEQDELIKLDMNLSDNLDVNLSDNID
FT                   INLDNELDEYFDEFLEGQGQEEKYSEEKNQDLLDDDIFNFSDDDNKEESKEKYFDNKNK
FT                   SSEYNNNNNNNNNNNNEDNNEDNNENNIDNDNDNNNNIDLDLSSLDFNNNDKNSIIIEN
FT                   DQLNDEDIFSEDLMNNNIKREENIIKSDEYNKLDMSNLKGNENMNEKNFITPYHENNND
FT                   NLSDTLQDERSIKSDINMNIDNNILYNSYIKNNENKKKNVLKMLLCGMENNLPAETNIT
FT                   IFWLFVQNGYREKRKKKKKKNDKEKDKDQNNNYNDPGDEIHFNFDENEKREDKNVAAYF
FT                   NYQCHEILYTIEKKKRYKNYIGKQNVLNEHENFKYNNIFLLPKFYPINKEYAILSKYIL
FT                   EIIKDIINYRINFFDYNNILHIFSTSKQINKILTNILFFLFNELDHNLRLNNIYASLML
FT                   LILLNGIIKNNNIDIDFYCLQILKMLIHVIIYEHELRLKNIYIILLLKRKACDIIIDFC
FT                   SVLKKQNNNEIINIDYYLIYILSKLLTHNKCTYMHIYVSYYLIYLMPINIHIKFFLSYT
FT                   PNFLTIFFKKYIYYQNVYSSFSSYDQKELNELFNFFFFHIYTLIQGSIYRIFKNINLLI
FT                   INSASCNYLNYLFNFIINYADYHLPLILCILNVIDKNYSPHKNDPIYHLQQKRKNSKKR
FT                   RLKKIKKIMMKRMKININKRRTKKKKKLKRNKKNNNKYLIKSKNYLKSVKDITKFYLNK
FT                   KPNSDNGDDSYYEDDYLNPESFNSNIFGYNNYSKKQYFNSYIKKRISLNKPLIQHSKEK
FT                   NELRTNIAVNNVLNKILNKFEKRRKKKKHKTKNHQYDAYLYDTCYYFLYTF"
     MMNKFYYSFK NKENENDATD KIKENIFMKD NNNYDYNENS YDKNSMYDDN KIIRKRSRKK        60
     KGEQDENMAS KNIERKSSFN SFHLDNENVN KDYYYENYDM DDNKYDKNGN VNYDNYNKND       120
     DLLYNKNDDM LYNKNDDIYN NKNKNDSSNY NNGNSLINPE FIKNIGICYN IINDETKFEN       180
     DTCFKKISDI IELRITQIIE EANKFYEKRK RYTINKYLSI EDLTNCCNYL NVVIPYKYKN       240
     SFFYNFITLN ENYKNNKIIY RLISKKEYPD YLKKRHSRKT YEKRKKKLYH MQMKKEKIKN       300
     MQNKNVKEKN INKKHNKYNK HNKLNKYTKK NKHKFKHSSK HMFKMIHNNF IGNEKKGTNN       360
     RTNLYNESYH TKKHKNKYTT HKNKINKHSK KNKKEHIKKD TEVDQINNKE SDITNHDKFN       420
     MFSENEKHDS PKEEQDELIK LDMNLSDNLD VNLSDNIDIN LDNELDEYFD EFLEGQGQEE       480
     KYSEEKNQDL LDDDIFNFSD DDNKEESKEK YFDNKNKSSE YNNNNNNNNN NNNEDNNEDN       540
     NENNIDNDND NNNNIDLDLS SLDFNNNDKN SIIIENDQLN DEDIFSEDLM NNNIKREENI       600
     IKSDEYNKLD MSNLKGNENM NEKNFITPYH ENNNDNLSDT LQDERSIKSD INMNIDNNIL       660
     YNSYIKNNEN KKKNVLKMLL CGMENNLPAE TNITIFWLFV QNGYREKRKK KKKKNDKEKD       720
     KDQNNNYNDP GDEIHFNFDE NEKREDKNVA AYFNYQCHEI LYTIEKKKRY KNYIGKQNVL       780
     NEHENFKYNN IFLLPKFYPI NKEYAILSKY ILEIIKDIIN YRINFFDYNN ILHIFSTSKQ       840
     INKILTNILF FLFNELDHNL RLNNIYASLM LLILLNGIIK NNNIDIDFYC LQILKMLIHV       900
     IIYEHELRLK NIYIILLLKR KACDIIIDFC SVLKKQNNNE IINIDYYLIY ILSKLLTHNK       960
     CTYMHIYVSY YLIYLMPINI HIKFFLSYTP NFLTIFFKKY IYYQNVYSSF SSYDQKELNE      1020
     LFNFFFFHIY TLIQGSIYRI FKNINLLIIN SASCNYLNYL FNFIINYADY HLPLILCILN      1080
     VIDKNYSPHK NDPIYHLQQK RKNSKKRRLK KIKKIMMKRM KININKRRTK KKKKLKRNKK      1140
     NNNKYLIKSK NYLKSVKDIT KFYLNKKPNS DNGDDSYYED DYLNPESFNS NIFGYNNYSK      1200
     KQYFNSYIKK RISLNKPLIQ HSKEKNELRT NIAVNNVLNK ILNKFEKRRK KKKHKTKNHQ      1260
     YDAYLYDTCY YFLYTF                                                      1276
//

If you have problems or comments...

PBIL Back to PBIL home page