(data stored in ACNUC9543 zone)

EMBL: AL844507.PE245

AL844507.PE245       Location/Qualifiers
FT   CDS             complement(1080055..1082991)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0824900"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0824900"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0027:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB83"
FT                   /protein_id="CAD51124.1"
FT                   /translation="MHMKLIDEVLTKWRRKEINLFKVCLYFHCIKKSLKLLEDKNDFFI
FT                   NLINDSIFEEIINLSKQKITDNNNNSNNNNNNNNSFNDEDKFFFVIFVTFIFNLENEYI
FT                   NDQNKGLLHLINNDNNKEYEKNIQHNKDKLKQNNKNIRDNSSQNLFNQNKYKKIDILIK
FT                   NIIDLEISQHISSPPKENKFINYKIYAYYAIIQFIFHILQNNDEQAGKIFSKYIKNIFT
FT                   TLLNINHTILCNENILSLANKTLLFIVFINHHLIKDNEKEFFNFLFIQLNKYNEYMLPI
FT                   IQEIFVTYLKKKKKLMLNKEIYQYLDNYLNDNISLLLKYGKKENLFFFLNVLSIYKIFI
FT                   KKYISNNDQNVYTIKNEDNVHIILNIKHIINNVNKLLEYLVHISKDYIYNNTNIDISLY
FT                   NQDSIYYNKPEENTNDKRTSYFVDNIIKEVDKEKYAINSVQSINHEFNTTLVQNYSLYQ
FT                   NNNLFSYITYHICTFFNDISNIIDTECISINTTYFIHFMKPFLSSHNNEDDLFLTYFLI
FT                   KHLYTYTENLLKKCPIIFDGFVNYIMYLFKHINLLTKNNFSITEQTNLINILNKIKNVE
FT                   HVNDIVDIYCTLYIHLVQNLSLFLKYLKYYNNEEIKEKILVHYEYFIFHVFHETNNVNF
FT                   HIIFKNNNAAFVTLKLLYNLLKINNFHFENIHNIYFKLCKVQNHLQNIHEQNSQHYLYT
FT                   YQNHMANTNSIFYLNKIKTFLLNNLDSISNDKKTPFYIANKKKKLKYKSPRQIKNIHHN
FT                   NNESGLVLSAQESVNSASQIINKQKKKKKKKDKKKKKKKKKNPLAEIKNPINDVKRSKQ
FT                   EINESNESLDERIDEEIERNSQNSIMDNNIISYNVNEIEQSQNLGKNEEYTEMEQEQNE
FT                   LNNDMMVTYNVTNNNEHMNKENDKLCNNENEYNEFNSISVKNKCDETLKKKMEKKKSLK
FT                   NKNLDHNNNVAHKNSLEIKTLKENIKMVSSSDAINSLKFMKQSILNDL"
     MHMKLIDEVL TKWRRKEINL FKVCLYFHCI KKSLKLLEDK NDFFINLIND SIFEEIINLS        60
     KQKITDNNNN SNNNNNNNNS FNDEDKFFFV IFVTFIFNLE NEYINDQNKG LLHLINNDNN       120
     KEYEKNIQHN KDKLKQNNKN IRDNSSQNLF NQNKYKKIDI LIKNIIDLEI SQHISSPPKE       180
     NKFINYKIYA YYAIIQFIFH ILQNNDEQAG KIFSKYIKNI FTTLLNINHT ILCNENILSL       240
     ANKTLLFIVF INHHLIKDNE KEFFNFLFIQ LNKYNEYMLP IIQEIFVTYL KKKKKLMLNK       300
     EIYQYLDNYL NDNISLLLKY GKKENLFFFL NVLSIYKIFI KKYISNNDQN VYTIKNEDNV       360
     HIILNIKHII NNVNKLLEYL VHISKDYIYN NTNIDISLYN QDSIYYNKPE ENTNDKRTSY       420
     FVDNIIKEVD KEKYAINSVQ SINHEFNTTL VQNYSLYQNN NLFSYITYHI CTFFNDISNI       480
     IDTECISINT TYFIHFMKPF LSSHNNEDDL FLTYFLIKHL YTYTENLLKK CPIIFDGFVN       540
     YIMYLFKHIN LLTKNNFSIT EQTNLINILN KIKNVEHVND IVDIYCTLYI HLVQNLSLFL       600
     KYLKYYNNEE IKEKILVHYE YFIFHVFHET NNVNFHIIFK NNNAAFVTLK LLYNLLKINN       660
     FHFENIHNIY FKLCKVQNHL QNIHEQNSQH YLYTYQNHMA NTNSIFYLNK IKTFLLNNLD       720
     SISNDKKTPF YIANKKKKLK YKSPRQIKNI HHNNNESGLV LSAQESVNSA SQIINKQKKK       780
     KKKKDKKKKK KKKKNPLAEI KNPINDVKRS KQEINESNES LDERIDEEIE RNSQNSIMDN       840
     NIISYNVNEI EQSQNLGKNE EYTEMEQEQN ELNNDMMVTY NVTNNNEHMN KENDKLCNNE       900
     NEYNEFNSIS VKNKCDETLK KKMEKKKSLK NKNLDHNNNV AHKNSLEIKT LKENIKMVSS       960
     SDAINSLKFM KQSILNDL                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page