(data stored in ACNUC9543 zone)

EMBL: AL844507.PE246

AL844507.PE246       Location/Qualifiers
FT   CDS             join(1086048..1090972,1091179..1091248)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0825000"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0825000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.29:mRNA"
FT                   /db_xref="GOA:C0H4X7"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4X7"
FT                   /protein_id="CAX64155.1"
FT                   /translation="MTSNYKSYNVLDYNLRFIQDEKRNRERERADNKNKENISLSINSD
FT                   MGNKIYLLETNAKSRKVEKDEKYKNISSSNYMKDKTYVDKNLGVKDDMSNLSSIKYNIE
FT                   INRNRNNNRNNNRNNNSNSNSFIMDEKEKTNNRTIMLLKHKRKYDPDYNTSDEKNIKRK
FT                   KINDIINKYKKKMIIPSYEENDEKYSNKGSFNISDDDEMDNKSSNYNISGKNYSTENND
FT                   NKNNFHIRSLEKMDKINNEMKEYSTKDSIDLRRVESISHGSKENNNIDKLKCHNLIRNK
FT                   NSNLVNFDRNKRKENFIFLHNYMKKKENGNKTNINSYDIENIHDEKKDKNEILNNLDIN
FT                   SYNEEKCLSYNNMKENDFNKIGISKQPNVDSKERKYNKYEKDHNIYNDLSDDGKSIDRT
FT                   NVYDNNSSSHNVSLSNLFNESNFMLDEKKIRDKFKEVKLIEKSLERNNSEIYENELKEG
FT                   ETHKKDELNKLVLDMTIKDINEKKKKVILYHKDYSENYERKSISSENIDIGPTNRSFLV
FT                   DGNNTKDMTHINENNDRDKNNDNINNDNIIINNDNNINNNNVYNVKESNEDIFYKANKL
FT                   SEKIDNIVQNIRNIKKIKKSNSGNYNIDANLSDGISNDEANLKNVTNSMDYTKLYYDDD
FT                   KGENTKNTFKKSAYDKNKKLLIENDTKLMIHGNNNQKEWIRNDEKYLLNGINNSPKDLD
FT                   NKRSNIDIQVNNNNNNNNDTTFYDAMEYSIGNDKEQYNKNVQEDHVIMGVESNKNNMQT
FT                   NCSSSNNKNYINNDRWNHLKEKYFDMMKPGVVDNIINIKENELVLQKNEKKKDIFNKSH
FT                   GNEKIEPLKDFNNKNVKVTNILKNKVNDDIHEDVKSVNIGNEIDENRKIKKKENILNSI
FT                   NQEKDIGNKNIINKTSYSKKNLLSKSYAEKPHLYNMKEKKKNNINVNKCKEKNPLFYSV
FT                   DFSNQKKNDIDKRMCDDLLSPGIDDSIERKIIYENIIKFSKRNVNNEHELVDTYSDGKK
FT                   KKEKSNERLKEELDMIKNYYSEEKLKREEEYKLRNEIQQKRKLYELKIRKDFEEKIRLR
FT                   REENEKRLNEEKINKIQQDNGKKELPNGIPDGKPNDMSSEENEKKHITYNNEKKNYDNI
FT                   EKNYDNIEKKNYDNNDGNNNNYYYDELRNETYKNNKKKKRKNLFEDYSSDGSYYKYMYR
FT                   NLYEETCNNKMKNHFYDISDNLYLQECSDNFFHNNKISSSSIYKSPSHSFDNELISLSK
FT                   IKFDDFDYNYLNELHKSVSKTKERKRSNYSDFSEDQKKLKNCNLVKPRVILTNSEKSYE
FT                   QKCGEHSKRGEEMNGEYEKGDIYKKNDIYKNSDMCEDNNVHQKNDIYEDNNIHQKNDIN
FT                   ERDDSHKKGDIYERNGFHEKNAVLKRNILNKNNNTGNLHNKNVGNSQKGKNRSLDYHRR
FT                   SNIQNFYEYKMNNNVDDNILNKLLTIKYENKIRNDSLSIKEDNIHNTKEGSVHEEMCEE
FT                   EEDFEEKYSEDIDIEDENISVKLNHNDSEYNKNNCKGVKLIQNKSDFNNENMDELNVSP
FT                   THTEIDKEEKQNVLLISTKEKSRIIKVNEKVDISPIKQIIQEEKNEPNDNINMDINDDE
FT                   DNEGKSKLKTSISSSENGIPKINILKNNENYIPLDIALNFVMDNEKLKKNLQKEEKKDK
FT                   GKKKTFVQWLMDERKRRLKNNLPIDI"
     MTSNYKSYNV LDYNLRFIQD EKRNRERERA DNKNKENISL SINSDMGNKI YLLETNAKSR        60
     KVEKDEKYKN ISSSNYMKDK TYVDKNLGVK DDMSNLSSIK YNIEINRNRN NNRNNNRNNN       120
     SNSNSFIMDE KEKTNNRTIM LLKHKRKYDP DYNTSDEKNI KRKKINDIIN KYKKKMIIPS       180
     YEENDEKYSN KGSFNISDDD EMDNKSSNYN ISGKNYSTEN NDNKNNFHIR SLEKMDKINN       240
     EMKEYSTKDS IDLRRVESIS HGSKENNNID KLKCHNLIRN KNSNLVNFDR NKRKENFIFL       300
     HNYMKKKENG NKTNINSYDI ENIHDEKKDK NEILNNLDIN SYNEEKCLSY NNMKENDFNK       360
     IGISKQPNVD SKERKYNKYE KDHNIYNDLS DDGKSIDRTN VYDNNSSSHN VSLSNLFNES       420
     NFMLDEKKIR DKFKEVKLIE KSLERNNSEI YENELKEGET HKKDELNKLV LDMTIKDINE       480
     KKKKVILYHK DYSENYERKS ISSENIDIGP TNRSFLVDGN NTKDMTHINE NNDRDKNNDN       540
     INNDNIIINN DNNINNNNVY NVKESNEDIF YKANKLSEKI DNIVQNIRNI KKIKKSNSGN       600
     YNIDANLSDG ISNDEANLKN VTNSMDYTKL YYDDDKGENT KNTFKKSAYD KNKKLLIEND       660
     TKLMIHGNNN QKEWIRNDEK YLLNGINNSP KDLDNKRSNI DIQVNNNNNN NNDTTFYDAM       720
     EYSIGNDKEQ YNKNVQEDHV IMGVESNKNN MQTNCSSSNN KNYINNDRWN HLKEKYFDMM       780
     KPGVVDNIIN IKENELVLQK NEKKKDIFNK SHGNEKIEPL KDFNNKNVKV TNILKNKVND       840
     DIHEDVKSVN IGNEIDENRK IKKKENILNS INQEKDIGNK NIINKTSYSK KNLLSKSYAE       900
     KPHLYNMKEK KKNNINVNKC KEKNPLFYSV DFSNQKKNDI DKRMCDDLLS PGIDDSIERK       960
     IIYENIIKFS KRNVNNEHEL VDTYSDGKKK KEKSNERLKE ELDMIKNYYS EEKLKREEEY      1020
     KLRNEIQQKR KLYELKIRKD FEEKIRLRRE ENEKRLNEEK INKIQQDNGK KELPNGIPDG      1080
     KPNDMSSEEN EKKHITYNNE KKNYDNIEKN YDNIEKKNYD NNDGNNNNYY YDELRNETYK      1140
     NNKKKKRKNL FEDYSSDGSY YKYMYRNLYE ETCNNKMKNH FYDISDNLYL QECSDNFFHN      1200
     NKISSSSIYK SPSHSFDNEL ISLSKIKFDD FDYNYLNELH KSVSKTKERK RSNYSDFSED      1260
     QKKLKNCNLV KPRVILTNSE KSYEQKCGEH SKRGEEMNGE YEKGDIYKKN DIYKNSDMCE      1320
     DNNVHQKNDI YEDNNIHQKN DINERDDSHK KGDIYERNGF HEKNAVLKRN ILNKNNNTGN      1380
     LHNKNVGNSQ KGKNRSLDYH RRSNIQNFYE YKMNNNVDDN ILNKLLTIKY ENKIRNDSLS      1440
     IKEDNIHNTK EGSVHEEMCE EEEDFEEKYS EDIDIEDENI SVKLNHNDSE YNKNNCKGVK      1500
     LIQNKSDFNN ENMDELNVSP THTEIDKEEK QNVLLISTKE KSRIIKVNEK VDISPIKQII      1560
     QEEKNEPNDN INMDINDDED NEGKSKLKTS ISSSENGIPK INILKNNENY IPLDIALNFV      1620
     MDNEKLKKNL QKEEKKDKGK KKTFVQWLMD ERKRRLKNNL PIDI                       1664
//

If you have problems or comments...

PBIL Back to PBIL home page