(data stored in ACNUC9543 zone)

EMBL: AL844507.PE247

AL844507.PE247       Location/Qualifiers
FT   CDS             join(1091998..1092058,1092147..1092205,1092376..1092471,
FT                   1092604..1092711,1092852..1092950,1093084..1093221)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0825100"
FT                   /product="ankyrin-repeat protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0825100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.28:mRNA"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB85"
FT                   /protein_id="CAD51122.1"
FT                   /translation="MISLTLISDRVRDKLSDLALWNIKRTKKLLKKNDINSKFLNNNNL
FT                   LQICSYNDDVEMFCFLLNRGCDFKHINDNGDTCLHIIVLNNNIYCLDILCRNNIKDIIN
FT                   IKNKDGDTALHISIKNGFYESFSLLLKYGVDILIKDDFDMDAYELLDVFRKKEKFYDSN
FT                   CNKYSIMFNLLIKEKMKGEIRKI"
     MISLTLISDR VRDKLSDLAL WNIKRTKKLL KKNDINSKFL NNNNLLQICS YNDDVEMFCF        60
     LLNRGCDFKH INDNGDTCLH IIVLNNNIYC LDILCRNNIK DIINIKNKDG DTALHISIKN       120
     GFYESFSLLL KYGVDILIKD DFDMDAYELL DVFRKKEKFY DSNCNKYSIM FNLLIKEKMK       180
     GEIRKI                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page