(data stored in ACNUC9543 zone)

EMBL: AL844507.PE249

AL844507.PE249       Location/Qualifiers
FT   CDS             complement(1095116..1095562)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0825300"
FT                   /product="SAYSvFN domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0825300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.26:mRNA"
FT                   /db_xref="GOA:Q8IB87"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR019387"
FT                   /db_xref="InterPro:IPR039159"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB87"
FT                   /protein_id="CAD51120.1"
FT                   /translation="MSKKKKNSKNKNINKYFNPKIVTAILLCSCYFLYNTFGSVYIIIV
FT                   LIAIIFLNLDNNNDSSISAYSIFNKGKRYLIGDLRMNQIENELRNTKYKNNDSEDNFLR
FT                   YDDIDKNKFYIKGSSKYNNKLCTCGSKKKFKKCCGIIKNSSSDF"
     MSKKKKNSKN KNINKYFNPK IVTAILLCSC YFLYNTFGSV YIIIVLIAII FLNLDNNNDS        60
     SISAYSIFNK GKRYLIGDLR MNQIENELRN TKYKNNDSED NFLRYDDIDK NKFYIKGSSK       120
     YNNKLCTCGS KKKFKKCCGI IKNSSSDF                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page