(data stored in ACNUC9543 zone)

EMBL: AL844507.PE250

AL844507.PE250       Location/Qualifiers
FT   CDS             join(1096423..1096462,1096652..1096738,1096900..1097055,
FT                   1097174..1097228,1097342..1097363)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0825400"
FT                   /product="ATP synthase-associated protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0825400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.25a:mRNA"
FT                   /db_xref="GOA:C0H4X8"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4X8"
FT                   /protein_id="CAX64156.1"
FT                   /translation="MQINKLEGKEKKAGICRRCFRGLFKSIKGPSITHSVLFGICGGLV
FT                   YYGSYYFYRFLKITYFDTQHVSNESRRRYMEKQMLFYNDFGYDLSMKYIGNLCKYYDPV
FT                   ALRLPFQPLDDKYRL"
     MQINKLEGKE KKAGICRRCF RGLFKSIKGP SITHSVLFGI CGGLVYYGSY YFYRFLKITY        60
     FDTQHVSNES RRRYMEKQML FYNDFGYDLS MKYIGNLCKY YDPVALRLPF QPLDDKYRL        119
//

If you have problems or comments...

PBIL Back to PBIL home page