(data stored in ACNUC9543 zone)

EMBL: AL844507.PE251

AL844507.PE251       Location/Qualifiers
FT   CDS             1098484..1100376
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0825500"
FT                   /product="protein KRI1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0825500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0026:mRNA"
FT                   /db_xref="GOA:Q8IB88"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR018034"
FT                   /db_xref="InterPro:IPR024626"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB88"
FT                   /protein_id="CAD51119.1"
FT                   /translation="MGKNKKRKNSRDINSCDNNIGVNKEKDNVINYNDIDKNLQKGDME
FT                   NMNSFDDNKEEIENNNNNNNNNQEEGLINGLKNNKMNDKIIEEKEDEISVSDDNSSSSD
FT                   EDHEGLLLTSKFKKKFSYLLLKLKSKDSNLLDKNNDNFFHDSDFETELSSDEESKEDEN
FT                   NDERKKKRMKLHHNVDDNNHNDDNHNKDDNKKERDMLNYSEYYKDILLKEGSQAFEKEE
FT                   EELLNKEKELSSKKNKKTYLDEQEELKKQIQEACKIADEQNDNIFDDNFFTIKEKSEQE
FT                   LLEEKKYYETFLKTSNMMKEENNLLKEYWKDNLSKDEEFLRDYILKEMWREDKVQNIYE
FT                   EIDEIDDEELEKAENFERTYNFRYEEQNGNMINSIPRKIESSVRQDIKKKKKKEKRREK
FT                   KKKLKEKKKKLLLDNLKNDEKDEEKNKKSNKINNNVYNTSGIKNNDQNMDNMNQKGKSN
FT                   KNSNKYNFDEEDLWFLCDLCNNPISPLCYVYECNICDNFALCKKCYKKNKHEHNLKKIL
FT                   VPRHCIPPQDYQNEELIAKDGQINNNNNNNNNNNNNNNIYDNNLMEYLENDSSAYEDLI
FT                   DDMPIRFKYIKVKPRSFKLSTDYILNTDDSTLNKVVPLKKVLPYYENKKKLVDT"
     MGKNKKRKNS RDINSCDNNI GVNKEKDNVI NYNDIDKNLQ KGDMENMNSF DDNKEEIENN        60
     NNNNNNNQEE GLINGLKNNK MNDKIIEEKE DEISVSDDNS SSSDEDHEGL LLTSKFKKKF       120
     SYLLLKLKSK DSNLLDKNND NFFHDSDFET ELSSDEESKE DENNDERKKK RMKLHHNVDD       180
     NNHNDDNHNK DDNKKERDML NYSEYYKDIL LKEGSQAFEK EEEELLNKEK ELSSKKNKKT       240
     YLDEQEELKK QIQEACKIAD EQNDNIFDDN FFTIKEKSEQ ELLEEKKYYE TFLKTSNMMK       300
     EENNLLKEYW KDNLSKDEEF LRDYILKEMW REDKVQNIYE EIDEIDDEEL EKAENFERTY       360
     NFRYEEQNGN MINSIPRKIE SSVRQDIKKK KKKEKRREKK KKLKEKKKKL LLDNLKNDEK       420
     DEEKNKKSNK INNNVYNTSG IKNNDQNMDN MNQKGKSNKN SNKYNFDEED LWFLCDLCNN       480
     PISPLCYVYE CNICDNFALC KKCYKKNKHE HNLKKILVPR HCIPPQDYQN EELIAKDGQI       540
     NNNNNNNNNN NNNNNIYDNN LMEYLENDSS AYEDLIDDMP IRFKYIKVKP RSFKLSTDYI       600
     LNTDDSTLNK VVPLKKVLPY YENKKKLVDT                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page