(data stored in ACNUC9543 zone)

EMBL: AL844507.PE254

AL844507.PE254       Location/Qualifiers
FT   CDS             1103768..1105108
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0825800"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0825800"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.25:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4X9"
FT                   /protein_id="CAX64157.2"
FT                   /translation="MKGRQSLSFLLLSVPYFFLFLWNEDIKCQSLLPVSYASHQMYSFD
FT                   KLTPHEIKSDLKKTFGNFISSKIQVLKNKFKLYDIKNREKYNNEEGNDSDLIGDAYISS
FT                   LEDEIKHLLEQAENKRMLSKKIKSSYERAHKNLKKRRNVEDDGKMKNVLKQNLQHIDYL
FT                   NKKSDYLEKKAGELKNILERRGNENAKEGNDNDEKNIYNNEYHNNCSISKRGTLKFINS
FT                   SNGLKHSIDNVNGMINENGFTIFYKNKKKMTYFWSVLELPIKMIGSIEQCFYFIYKNNN
FT                   QIFCADNKIKAYSWMNSLSEASLCFHFGIKGVLINSNINNINKNDDMNNTNDENVKHSD
FT                   FMNNISNGIKQGKKNKQKKIDENSLTVDIKPEDTGTRIFVNDVEQKINKDVPGKDNVFN
FT                   LNDIKKKMDDERKTPQSENDEDQQGGYDKMEENEKEDTQMDNDDYEM"
     MKGRQSLSFL LLSVPYFFLF LWNEDIKCQS LLPVSYASHQ MYSFDKLTPH EIKSDLKKTF        60
     GNFISSKIQV LKNKFKLYDI KNREKYNNEE GNDSDLIGDA YISSLEDEIK HLLEQAENKR       120
     MLSKKIKSSY ERAHKNLKKR RNVEDDGKMK NVLKQNLQHI DYLNKKSDYL EKKAGELKNI       180
     LERRGNENAK EGNDNDEKNI YNNEYHNNCS ISKRGTLKFI NSSNGLKHSI DNVNGMINEN       240
     GFTIFYKNKK KMTYFWSVLE LPIKMIGSIE QCFYFIYKNN NQIFCADNKI KAYSWMNSLS       300
     EASLCFHFGI KGVLINSNIN NINKNDDMNN TNDENVKHSD FMNNISNGIK QGKKNKQKKI       360
     DENSLTVDIK PEDTGTRIFV NDVEQKINKD VPGKDNVFNL NDIKKKMDDE RKTPQSENDE       420
     DQQGGYDKME ENEKEDTQMD NDDYEM                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page