(data stored in ACNUC9543 zone)

EMBL: AL844507.PE255

AL844507.PE255       Location/Qualifiers
FT   CDS             1106048..1107961
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0825900"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0825900"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0023:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB92"
FT                   /protein_id="CAD51115.1"
FT                   /translation="MLNIFSNEDLSLPAEKEEEEEEKLEKSKDKKDLDKIESKKIDRKF
FT                   SHGSYLSKYDSKRLYYNKRLETKIKSLRKSFRKRYRIVRNNLMKLIKVLKEFPDIKQIK
FT                   EHETTDGKITINIDVVQKLNKIMDKINIEKLKYNNKKEKRKKKKGIKNKSRNINSNSNT
FT                   NRNRSRYKSEEYLYPKKKLSKISFSSTLFPLSKRIRYKSNINSLSMENKKNKRKRKKKK
FT                   KKKKKENNIQNEKLHKRKNIYSKRGNIFSKSKTFGKLHRRRIYKNPYEHRKTFYENIYE
FT                   NLNENLNQHIYENMYENLNQNIYENMYENLNTNMFEITNDNNPQKKYNNTYNNMFENLY
FT                   GNVYPNELELSYERELDNVYKSLNVNGSHNLNNNSHKYKFQKTFYHNALQNYYPNTSLP
FT                   FNKNYLKNNNFYYYYMNLKNKKHQNVNHYNDTNNVLVTDFYMYSTLNASFNRLNSLKNK
FT                   NNFHLFNRNIPNVYLKRANDIIGFNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNKIE
FT                   STYMEHDFLKNLPYTMNNNSNNNMLLKYYPEQHTYVHNITESFFSPNKIFTIRKGKKNK
FT                   TTNQNKHKLKKFVKDEKIRNLLRTATNEDELLRAINFAKNAGLEFEAKLGDKKLNKLKC
FT                   TS"
     MLNIFSNEDL SLPAEKEEEE EEKLEKSKDK KDLDKIESKK IDRKFSHGSY LSKYDSKRLY        60
     YNKRLETKIK SLRKSFRKRY RIVRNNLMKL IKVLKEFPDI KQIKEHETTD GKITINIDVV       120
     QKLNKIMDKI NIEKLKYNNK KEKRKKKKGI KNKSRNINSN SNTNRNRSRY KSEEYLYPKK       180
     KLSKISFSST LFPLSKRIRY KSNINSLSME NKKNKRKRKK KKKKKKKENN IQNEKLHKRK       240
     NIYSKRGNIF SKSKTFGKLH RRRIYKNPYE HRKTFYENIY ENLNENLNQH IYENMYENLN       300
     QNIYENMYEN LNTNMFEITN DNNPQKKYNN TYNNMFENLY GNVYPNELEL SYERELDNVY       360
     KSLNVNGSHN LNNNSHKYKF QKTFYHNALQ NYYPNTSLPF NKNYLKNNNF YYYYMNLKNK       420
     KHQNVNHYND TNNVLVTDFY MYSTLNASFN RLNSLKNKNN FHLFNRNIPN VYLKRANDII       480
     GFNNNNNNNN NNNNNNNNNN NNNNNNNNNS NNNNKIESTY MEHDFLKNLP YTMNNNSNNN       540
     MLLKYYPEQH TYVHNITESF FSPNKIFTIR KGKKNKTTNQ NKHKLKKFVK DEKIRNLLRT       600
     ATNEDELLRA INFAKNAGLE FEAKLGDKKL NKLKCTS                                637
//

If you have problems or comments...

PBIL Back to PBIL home page