(data stored in ACNUC9543 zone)

EMBL: AL844507.PE256

AL844507.PE256       Location/Qualifiers
FT   CDS             1109276..1112794
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0826000"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0826000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.24:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB93"
FT                   /protein_id="CAD51114.1"
FT                   /translation="MKKKGNLQEFFFSVINYTFLFKNNFHCSINNINNKNRFCFFIYIK
FT                   DFSASYSTINNNSSWVNNIRVTNKYLTKKRYMKETKHTILCRTNKNNYSILADVLIKDK
FT                   NNEDIKIANKEKEKEKEKEIKANKKLIKEGEKINKKVKKEVKKNPQFVVNKTMIPLKEE
FT                   TNNMNIILDEKNNKKKKKKKKKINVMTDMKENTQVDKKKHISISNETSSVTIYSTDMKE
FT                   NVNNNINRNEEDPTINNDDKVVCSDILLNKEQTSNNITKEKKKEKMKKGKETKVKQKNV
FT                   LSKNTNEKCVNTSEKCVNTIEKCVNTNEKCVNTNEKCVNTNEKCVNTNEKCVNTNEKCV
FT                   NTNEKCVNTNEKCVNTNEKCVNTNEKIVNTNKKFVNTNKKFVNTNEKCVNTNEKCVNSY
FT                   NVLNNHENVTINNNFNEEEYFKEFEQIGIKNNIIIKKINTIEDINKFVNKYENSLGYCN
FT                   IYAYNNLLYEIYDKFSNCDIKRVKKLIKNYNKLTKKNLQKKIKCFESFYEICPTKYNEV
FT                   LTCLFIQSVDILKAEDISNTFYFDNILNINKEENEHENENSDVGRECITTSEKANYDYY
FT                   NYDYEINEEGEKRKIHNINYRRNEGYVHNKIVYDIDVKFSSKNERNHINENNFIIVYDL
FT                   PILSYDLLTKELKETFSFCGKIKAIEFFNDRLKTIDMNMINNENESKDIGTVNSSKNSC
FT                   KLKNRVNNNGRKKGNHKGKDINFDNNDNNDDNNDNNNDDNNDNNKNNNNDNNKNNNNNN
FT                   NNNNNNNNNNNNNNNNNNNNDNNKQNIDNICNYNISNKNPQNENVKKKYPQKINKIVNP
FT                   NQSTQLYGIIEFYDSKSADMATSDFLRIFGIFCYNKLIYVDKCVHKNIMIITHLPFHLN
FT                   IYNILYLLLNASLYNFDISLIKEEEKLNSKKYDMIKNVEGIINNNMYSSEENIINDNNK
FT                   FISNEKLEIIDNKEVLLKGSYKKPEQNYIYNNDNSLENKFDSFCPNEKDINLINTDNEK
FT                   ENNIINNIMSNSKTCENETTKMCSFVLRNSNIKIENNDSHFKEIYKNSTDIYNYIYEIS
FT                   KINFKHFEEKINRHLQTNISSNNNNNNNNNKNNYESFVDFYQNKNKKMITRKVHINNNG
FT                   RTLILHFDNFTNLFECLKKFKYIFKNKNYMIFSLNLKRCIFLNGEIKDHVHIQNDRRKI
FT                   GINIDQ"
     MKKKGNLQEF FFSVINYTFL FKNNFHCSIN NINNKNRFCF FIYIKDFSAS YSTINNNSSW        60
     VNNIRVTNKY LTKKRYMKET KHTILCRTNK NNYSILADVL IKDKNNEDIK IANKEKEKEK       120
     EKEIKANKKL IKEGEKINKK VKKEVKKNPQ FVVNKTMIPL KEETNNMNII LDEKNNKKKK       180
     KKKKKINVMT DMKENTQVDK KKHISISNET SSVTIYSTDM KENVNNNINR NEEDPTINND       240
     DKVVCSDILL NKEQTSNNIT KEKKKEKMKK GKETKVKQKN VLSKNTNEKC VNTSEKCVNT       300
     IEKCVNTNEK CVNTNEKCVN TNEKCVNTNE KCVNTNEKCV NTNEKCVNTN EKCVNTNEKC       360
     VNTNEKIVNT NKKFVNTNKK FVNTNEKCVN TNEKCVNSYN VLNNHENVTI NNNFNEEEYF       420
     KEFEQIGIKN NIIIKKINTI EDINKFVNKY ENSLGYCNIY AYNNLLYEIY DKFSNCDIKR       480
     VKKLIKNYNK LTKKNLQKKI KCFESFYEIC PTKYNEVLTC LFIQSVDILK AEDISNTFYF       540
     DNILNINKEE NEHENENSDV GRECITTSEK ANYDYYNYDY EINEEGEKRK IHNINYRRNE       600
     GYVHNKIVYD IDVKFSSKNE RNHINENNFI IVYDLPILSY DLLTKELKET FSFCGKIKAI       660
     EFFNDRLKTI DMNMINNENE SKDIGTVNSS KNSCKLKNRV NNNGRKKGNH KGKDINFDNN       720
     DNNDDNNDNN NDDNNDNNKN NNNDNNKNNN NNNNNNNNNN NNNNNNNNNN NNNDNNKQNI       780
     DNICNYNISN KNPQNENVKK KYPQKINKIV NPNQSTQLYG IIEFYDSKSA DMATSDFLRI       840
     FGIFCYNKLI YVDKCVHKNI MIITHLPFHL NIYNILYLLL NASLYNFDIS LIKEEEKLNS       900
     KKYDMIKNVE GIINNNMYSS EENIINDNNK FISNEKLEII DNKEVLLKGS YKKPEQNYIY       960
     NNDNSLENKF DSFCPNEKDI NLINTDNEKE NNIINNIMSN SKTCENETTK MCSFVLRNSN      1020
     IKIENNDSHF KEIYKNSTDI YNYIYEISKI NFKHFEEKIN RHLQTNISSN NNNNNNNNKN      1080
     NYESFVDFYQ NKNKKMITRK VHINNNGRTL ILHFDNFTNL FECLKKFKYI FKNKNYMIFS      1140
     LNLKRCIFLN GEIKDHVHIQ NDRRKIGINI DQ                                    1172
//

If you have problems or comments...

PBIL Back to PBIL home page