(data stored in ACNUC9543 zone)

EMBL: AL844507.PE26

AL844507.PE26        Location/Qualifiers
FT   CDS             join(188566..188761,188857..189257,189384..189557,
FT                   189655..190020,190221..190316)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0802700"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0802700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.149:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAM7"
FT                   /protein_id="CAD51336.1"
FT                   /translation="MQLPFKKSYDETKETDINVSLTKNNENQIGYEETEKQLNTGVSNL
FT                   SDVSQIKSEIYDNILNMYNNETKSSEHNHKSKSKIEDNYFNDQQNEHTPILHQHSLENQ
FT                   KKDEEDYILDEEIINETLENEYPYDENIYQQEKTKYTSQYEYYKIHDDKIEKDKNENAL
FT                   NQNNRNQYKIIKKNKIKLSTTSDEVKNYSTNHITHEDIILDIYKNTLEHKKTNFLCLEE
FT                   ILKNINLILKKQIDLNHSNEIEKSERKILLKNIYQIKKHIEDKSFNSLNNKDFIKYFIK
FT                   NFPKEETRVSELKLNEETKKDTIKFNISYNLNGNKKNDHTYIKRNNEQFIETNKNFHLF
FT                   LSHLNQLEKSILTFTHFCTNISNQTHTENNIYLNTFENKVYLFVQNPEAMRLVRKLEKN
FT                   MNRIKSICLHI"
     MQLPFKKSYD ETKETDINVS LTKNNENQIG YEETEKQLNT GVSNLSDVSQ IKSEIYDNIL        60
     NMYNNETKSS EHNHKSKSKI EDNYFNDQQN EHTPILHQHS LENQKKDEED YILDEEIINE       120
     TLENEYPYDE NIYQQEKTKY TSQYEYYKIH DDKIEKDKNE NALNQNNRNQ YKIIKKNKIK       180
     LSTTSDEVKN YSTNHITHED IILDIYKNTL EHKKTNFLCL EEILKNINLI LKKQIDLNHS       240
     NEIEKSERKI LLKNIYQIKK HIEDKSFNSL NNKDFIKYFI KNFPKEETRV SELKLNEETK       300
     KDTIKFNISY NLNGNKKNDH TYIKRNNEQF IETNKNFHLF LSHLNQLEKS ILTFTHFCTN       360
     ISNQTHTENN IYLNTFENKV YLFVQNPEAM RLVRKLEKNM NRIKSICLHI                  410
//

If you have problems or comments...

PBIL Back to PBIL home page