(data stored in ACNUC9543 zone)

EMBL: AL844507.PE262

AL844507.PE262       Location/Qualifiers
FT   CDS             complement(1157321..1158151)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0826600"
FT                   /product="SNARE protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0826600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.21:mRNA"
FT                   /db_xref="GOA:Q8IB99"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB99"
FT                   /protein_id="CAD51108.1"
FT                   /translation="MFILSDDDVAYSNSINSEEIEESDYENSEAHSRYYEETDEEESNN
FT                   NDIDDEDLCLFKYVCIGSLDDVDILLKYSLFNRDIDKSANFIVKKILIASKKKLNYCNK
FT                   KILNWDNHIIYFIICTDKKLALFLIGLDLKASFKNYAFEFLRKLEIYAKSNLFYDKNYV
FT                   SSHVNPSKVHTIECFMKTTIKNLNKCCKNEKLFAVKQKLNKINSVMNNHIDTLYKSRGN
FT                   IKALQYKTEDMSKNTLNFVQNTKKLKRIMFLKYWKTYFLCACFLIIGFKVYRSI"
     MFILSDDDVA YSNSINSEEI EESDYENSEA HSRYYEETDE EESNNNDIDD EDLCLFKYVC        60
     IGSLDDVDIL LKYSLFNRDI DKSANFIVKK ILIASKKKLN YCNKKILNWD NHIIYFIICT       120
     DKKLALFLIG LDLKASFKNY AFEFLRKLEI YAKSNLFYDK NYVSSHVNPS KVHTIECFMK       180
     TTIKNLNKCC KNEKLFAVKQ KLNKINSVMN NHIDTLYKSR GNIKALQYKT EDMSKNTLNF       240
     VQNTKKLKRI MFLKYWKTYF LCACFLIIGF KVYRSI                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page