(data stored in ACNUC9543 zone)

EMBL: AL844507.PE263

AL844507.PE263       Location/Qualifiers
FT   CDS             complement(join(1160164..1161005,1161579..1161708))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0826700"
FT                   /product="receptor for activated c kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0826700"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0019:mRNA"
FT                   /db_xref="GOA:Q8IBA0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBA0"
FT                   /protein_id="CAD51107.1"
FT                   /translation="MMDNIKEAEISLRGVLEGGHSDWVTSVSTPTDPKLKTIVSASRDK
FT                   KLIVWNINTDDDSGEIGTAKKSLTGHSQAINDVSISSDGLFALSGSWDHSVRLWDLSLG
FT                   ETIRSFIGHTSDVFSVSFSPDNRQIVSASRDKTIKLWNTLAQCKYTITDQQHTDWITCV
FT                   RFSPSPNQAIIVSCGWDKLVKVWNLKNCDLNKNLEGHTGVLNTVTISPDGSLCASGGKD
FT                   GVAKLWDVKEGKHLYSLETGSTINSLCFSPCDYWLCAATDRFIRIWNLESKLIISEIYP
FT                   VKQSKIGVPWCTSLTWSANGQLLYCGSTDGNIYVYEVKKHSV"
     MMDNIKEAEI SLRGVLEGGH SDWVTSVSTP TDPKLKTIVS ASRDKKLIVW NINTDDDSGE        60
     IGTAKKSLTG HSQAINDVSI SSDGLFALSG SWDHSVRLWD LSLGETIRSF IGHTSDVFSV       120
     SFSPDNRQIV SASRDKTIKL WNTLAQCKYT ITDQQHTDWI TCVRFSPSPN QAIIVSCGWD       180
     KLVKVWNLKN CDLNKNLEGH TGVLNTVTIS PDGSLCASGG KDGVAKLWDV KEGKHLYSLE       240
     TGSTINSLCF SPCDYWLCAA TDRFIRIWNL ESKLIISEIY PVKQSKIGVP WCTSLTWSAN       300
     GQLLYCGSTD GNIYVYEVKK HSV                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page