(data stored in ACNUC9543 zone)

EMBL: AL844507.PE267

AL844507.PE267       Location/Qualifiers
FT   CDS             1177310..1180324
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0827200"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0827200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0017:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBA4"
FT                   /protein_id="CAD51103.1"
FT                   /translation="MVPLYEEAGIIMDDVSGVILFYEDVINEMKGSYNSLYDNMILLKN
FT                   KMENIKEQNKIIIKENDSKEKYFNSSNMLNDILCNKLGLINMTTENRNNEGVNDRENNN
FT                   NNDDDNNKYGDNNKYGDNNKYGDNNKYGDNNKYGDNNKCGDNNKYGDNNKYGDNNKYGD
FT                   NNKYGDNNKYGDNNKYGDHNNDYYYNNILSFQNKPLCYNNQLKKYDSKIIKLDENIFNT
FT                   LKEENEMGSNNGKDISTESSKDERSNVNMDDIYSDNFLNAESSINSNKVSPIILSDENK
FT                   KLSNFLKEKKREYQKIISSNKKEDVLNILSDANNEDNTQKEINNNNNNNNNNSNNNNSN
FT                   NNNSNNNNSNSNLYGYDNNKFVPPCTKGQNINGTHMFTQEDDNKKDEKKYGIHYSIKKN
FT                   TKIYREDMKNYKKSTNSKNNSLLHDNKKKKKKKKKKKNKNKNNKMNNNIYNNMKNKMKE
FT                   IFNFMNNIYNNKQINNCYEDHFPFFLLPKEDSMILENMELYLSSKYNKESSHKSCNPTN
FT                   NIQEYNNKYINDENDIDNLTNIQDSISSFGKKLNYINESNETIRNYSINNLCKIMNEDN
FT                   QKGFNKNSFIYNDKNKNINYKGENNMNIHNSNVYENKYEMNFDNKNEKFNIPNKRYIYL
FT                   NGDDSNYKKKKQRTNKKKIQNNSNISNNIYTSSSVGCPHCTCITHKNISMTRGKTYSYY
FT                   SDESNQHTNNLIKFMNPKTIMSNKLISNFIDIDRNPIFVPAYNQRYGVLSDVEEVEQKE
FT                   KKNNNNKKIKKIKNKKKNKKKKNKKINKKINKKINKKINNGTVKLTFDENVNKTSFEKD
FT                   KENILDDTIINNNDDNNNDNNYLCMDTIMSTSNNSHSCNDSDLKRYDKKNDHVTDSFKN
FT                   NKNDKELCKNKNLLCNKKDRNKNKMITEGIKDDSNIEKKRKRGNHQKYEEVGNDINQKK
FT                   RKDKESLLYVNNNNNDQINDIILNDVHHIKKYELRRQKKITYILPSLNKKLRRDSCRLI
FT                   FDPFGYNNTWKIKTT"
     MVPLYEEAGI IMDDVSGVIL FYEDVINEMK GSYNSLYDNM ILLKNKMENI KEQNKIIIKE        60
     NDSKEKYFNS SNMLNDILCN KLGLINMTTE NRNNEGVNDR ENNNNNDDDN NKYGDNNKYG       120
     DNNKYGDNNK YGDNNKYGDN NKCGDNNKYG DNNKYGDNNK YGDNNKYGDN NKYGDNNKYG       180
     DHNNDYYYNN ILSFQNKPLC YNNQLKKYDS KIIKLDENIF NTLKEENEMG SNNGKDISTE       240
     SSKDERSNVN MDDIYSDNFL NAESSINSNK VSPIILSDEN KKLSNFLKEK KREYQKIISS       300
     NKKEDVLNIL SDANNEDNTQ KEINNNNNNN NNNSNNNNSN NNNSNNNNSN SNLYGYDNNK       360
     FVPPCTKGQN INGTHMFTQE DDNKKDEKKY GIHYSIKKNT KIYREDMKNY KKSTNSKNNS       420
     LLHDNKKKKK KKKKKKNKNK NNKMNNNIYN NMKNKMKEIF NFMNNIYNNK QINNCYEDHF       480
     PFFLLPKEDS MILENMELYL SSKYNKESSH KSCNPTNNIQ EYNNKYINDE NDIDNLTNIQ       540
     DSISSFGKKL NYINESNETI RNYSINNLCK IMNEDNQKGF NKNSFIYNDK NKNINYKGEN       600
     NMNIHNSNVY ENKYEMNFDN KNEKFNIPNK RYIYLNGDDS NYKKKKQRTN KKKIQNNSNI       660
     SNNIYTSSSV GCPHCTCITH KNISMTRGKT YSYYSDESNQ HTNNLIKFMN PKTIMSNKLI       720
     SNFIDIDRNP IFVPAYNQRY GVLSDVEEVE QKEKKNNNNK KIKKIKNKKK NKKKKNKKIN       780
     KKINKKINKK INNGTVKLTF DENVNKTSFE KDKENILDDT IINNNDDNNN DNNYLCMDTI       840
     MSTSNNSHSC NDSDLKRYDK KNDHVTDSFK NNKNDKELCK NKNLLCNKKD RNKNKMITEG       900
     IKDDSNIEKK RKRGNHQKYE EVGNDINQKK RKDKESLLYV NNNNNDQIND IILNDVHHIK       960
     KYELRRQKKI TYILPSLNKK LRRDSCRLIF DPFGYNNTWK IKTT                       1004
//

If you have problems or comments...

PBIL Back to PBIL home page