(data stored in SCRATCH zone)

EMBL: AL844507.PE268

AL844507.PE268       Location/Qualifiers
FT   CDS             1181295..1183796
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0827300"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0827300"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0016:mRNA"
FT                   /db_xref="GOA:Q8IBA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBA5"
FT                   /protein_id="CAD51102.1"
FT                   /translation="MVLPLLFINYKNNKYKNEYAYKHVVKCYNLPEFMYEGFFEFLIKK
FT                   YNNEDLYKIDEIIKPSYEETKLYPLKIICNKNLGNFLIKKEKILVVDDIMENNKVYIKI
FT                   DNDKNEYNNNDDVIYDNIHINVEDKKECIQKVSFENNMYIDQGKKTKTEDKQYINNNIF
FT                   NDLVDNSNVTLKEDNNVTSGDYAYINVHNCVNDENYMMNKRNVQSIERDINKNKKEVQY
FT                   CEYVDDEMNNLPHNNNNKKNNNNNNNNNNNNDNIYENKYDYYSCCYSDQFDESDSDYSV
FT                   ICAHNNNNNIITCHETCSYNDEHQKYKNKNVKYIEDENNNTGDYASNTSETKSGYSSYK
FT                   YNNIINYKNNQKNNKKCKKIFYIYFVEGNVQEFIQDINEEDKNKIEEDIIDKILNEEKE
FT                   NINKKHVENDTYNINNKNNSIQGYIYNLHNQNCYQDNEEYVNSAEMETGRINQEDKSDI
FT                   SLSTCCMQSEKNKENEKYDKFVQNKENETYDKFVQNKENEKYDKFVQNKENEKYDKFVQ
FT                   NKENEKYDKFVQNKENETYDKFVQNKENEKYDKFVQNKENEKYDKFVQNKENEKYDKFA
FT                   QNKENEKYDKFVQNNKNEEHMLDDNKEKDLIHSSMRSDYSNTNVKENDMKVIWPNKLSW
FT                   KEISNEIKKKLCVVIKNKPAEWNHYDLQNFLVSQFHNKNYIPTFQDIFITKSCPTIATV
FT                   AFKNEEERNYFLDHQKFKLPNLKHHHKDLNKNNIYYNKYSNFLVLQEYVISYNTQSNNN
FT                   PKKYYQDKYEQNIYKDYESRQKRKYNNFYDHYNHNFHSKKYSDVSINKYKKKINFNNNY
FT                   DINSNVKRKKVSTSYERNDDS"
     MVLPLLFINY KNNKYKNEYA YKHVVKCYNL PEFMYEGFFE FLIKKYNNED LYKIDEIIKP        60
     SYEETKLYPL KIICNKNLGN FLIKKEKILV VDDIMENNKV YIKIDNDKNE YNNNDDVIYD       120
     NIHINVEDKK ECIQKVSFEN NMYIDQGKKT KTEDKQYINN NIFNDLVDNS NVTLKEDNNV       180
     TSGDYAYINV HNCVNDENYM MNKRNVQSIE RDINKNKKEV QYCEYVDDEM NNLPHNNNNK       240
     KNNNNNNNNN NNNDNIYENK YDYYSCCYSD QFDESDSDYS VICAHNNNNN IITCHETCSY       300
     NDEHQKYKNK NVKYIEDENN NTGDYASNTS ETKSGYSSYK YNNIINYKNN QKNNKKCKKI       360
     FYIYFVEGNV QEFIQDINEE DKNKIEEDII DKILNEEKEN INKKHVENDT YNINNKNNSI       420
     QGYIYNLHNQ NCYQDNEEYV NSAEMETGRI NQEDKSDISL STCCMQSEKN KENEKYDKFV       480
     QNKENETYDK FVQNKENEKY DKFVQNKENE KYDKFVQNKE NEKYDKFVQN KENETYDKFV       540
     QNKENEKYDK FVQNKENEKY DKFVQNKENE KYDKFAQNKE NEKYDKFVQN NKNEEHMLDD       600
     NKEKDLIHSS MRSDYSNTNV KENDMKVIWP NKLSWKEISN EIKKKLCVVI KNKPAEWNHY       660
     DLQNFLVSQF HNKNYIPTFQ DIFITKSCPT IATVAFKNEE ERNYFLDHQK FKLPNLKHHH       720
     KDLNKNNIYY NKYSNFLVLQ EYVISYNTQS NNNPKKYYQD KYEQNIYKDY ESRQKRKYNN       780
     FYDHYNHNFH SKKYSDVSIN KYKKKINFNN NYDINSNVKR KKVSTSYERN DDS              833
//

If you have problems or comments...

PBIL Back to PBIL home page