(data stored in ACNUC9543 zone)

EMBL: AL844507.PE269

AL844507.PE269       Location/Qualifiers
FT   CDS             1184595..1185251
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0827400"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0827400"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0015:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBA6"
FT                   /protein_id="CAD51101.1"
FT                   /translation="MRKESFLFFICTLNLLINSFFCYGGKVKKNKHLRNLLKTLTDRIE
FT                   TNDGENEYARLTQTPVINMNLEKTIFKTSLQDILVEPYAEKIKEIISKNNYEISKEKEN
FT                   LDEIRYYNDNLDKINNILIERENEKKKKKRKNIQLENKLRNKYFHYLQDQDYGFSIFPV
FT                   YKTFESNPLHFDNNIISSLLPHELLDKGILLNKQILENSEKILHYPERGDTLYEI"
     MRKESFLFFI CTLNLLINSF FCYGGKVKKN KHLRNLLKTL TDRIETNDGE NEYARLTQTP        60
     VINMNLEKTI FKTSLQDILV EPYAEKIKEI ISKNNYEISK EKENLDEIRY YNDNLDKINN       120
     ILIERENEKK KKKRKNIQLE NKLRNKYFHY LQDQDYGFSI FPVYKTFESN PLHFDNNIIS       180
     SLLPHELLDK GILLNKQILE NSEKILHYPE RGDTLYEI                               218
//

If you have problems or comments...

PBIL Back to PBIL home page