(data stored in ACNUC9543 zone)

EMBL: AL844507.PE27

AL844507.PE27        Location/Qualifiers
FT   CDS             join(191976..192041,192355..194103)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0802800"
FT                   /product="serine/threonine protein phosphatase 2B catalytic
FT                   subunit A"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0802800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0129:mRNA"
FT                   /db_xref="GOA:Q8IAM8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR041751"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAM8"
FT                   /protein_id="CAD51335.1"
FT                   /translation="MEPLPDPKNDRQVKDVEPPPAKPLSLELLYPNGTEEPPDYKALRD
FT                   HLKKEGRIRKEDCLDIIKKVIDIVSNEPNLLRLKDPITIVGDIHGQYYDLLKLLEVGGN
FT                   PDHTQFLFLGDYVDRGSFSIEVLLLLYALKINFPDRIWLIRGNHECRQMTTFFNFRDEC
FT                   EYKYDIVVYYAFMESFDTIPLSAVINGKFLGVHGGLSPDLILLNQICSFTRFQEPPRSG
FT                   IFCDILWSDPIDEDKEEHTIQTESYFPNDIRGCSYFFGYNAATTFLEKNGLLSIIRAHE
FT                   AQLEGYKMHQTNLKTGFPIVITIFSAPNYCDVYNNKGAVLKFDSNTLNIQQFSFSPHPY
FT                   HLPNFMNLFTWSLPFVSEKVTEMLYSLLNCSMNDTDEGINDIVLPKEVIQILNYIEENN
FT                   KRINEMNFNNNDDNVQYEDNGPYINQSNNNNNNNNKDNKFDDITYDDHKKEKDKRNKIS
FT                   SNGNMQDNNQLYDHSEGHNNYNDEDEFFKNVKKTDTNNNNNNEEEDEEEDEEEEEDGRK
FT                   TKDVGQVSKERTDTLRKKVQSVGRLMRVFRTLRKENELIVQLKGCSPGYRIPVGLLLSG
FT                   KEGLENELEKFTKVKEIDSINEKRPSNE"
     MEPLPDPKND RQVKDVEPPP AKPLSLELLY PNGTEEPPDY KALRDHLKKE GRIRKEDCLD        60
     IIKKVIDIVS NEPNLLRLKD PITIVGDIHG QYYDLLKLLE VGGNPDHTQF LFLGDYVDRG       120
     SFSIEVLLLL YALKINFPDR IWLIRGNHEC RQMTTFFNFR DECEYKYDIV VYYAFMESFD       180
     TIPLSAVING KFLGVHGGLS PDLILLNQIC SFTRFQEPPR SGIFCDILWS DPIDEDKEEH       240
     TIQTESYFPN DIRGCSYFFG YNAATTFLEK NGLLSIIRAH EAQLEGYKMH QTNLKTGFPI       300
     VITIFSAPNY CDVYNNKGAV LKFDSNTLNI QQFSFSPHPY HLPNFMNLFT WSLPFVSEKV       360
     TEMLYSLLNC SMNDTDEGIN DIVLPKEVIQ ILNYIEENNK RINEMNFNNN DDNVQYEDNG       420
     PYINQSNNNN NNNNKDNKFD DITYDDHKKE KDKRNKISSN GNMQDNNQLY DHSEGHNNYN       480
     DEDEFFKNVK KTDTNNNNNN EEEDEEEDEE EEEDGRKTKD VGQVSKERTD TLRKKVQSVG       540
     RLMRVFRTLR KENELIVQLK GCSPGYRIPV GLLLSGKEGL ENELEKFTKV KEIDSINEKR       600
     PSNE                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page