(data stored in ACNUC9543 zone)

EMBL: AL844507.PE270

AL844507.PE270       Location/Qualifiers
FT   CDS             1186175..1187125
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0827500"
FT                   /product="ribosomal protein L21, apicoplast, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0827500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0014:mRNA"
FT                   /db_xref="GOA:C0H4Y5"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Y5"
FT                   /protein_id="CAX64160.1"
FT                   /translation="MFFFSSKNKSFLLWASFMLIYFTNISIYVSKIHHHGLNKKIYNLN
FT                   FVSNVFKYNARRRGNSLNVLINSPAQVKLSEMEDAKDRSGKYCIIEICGKIRWVEEGRF
FT                   YDVFRIKQEENRNIYLNRILFYSNEEGNIFFGRPFLDNVRIHATVLNHFRGHKIYRLKY
FT                   KPKKNYKRFYGHRQEMTRIKINKIEYNNELLGQEKRIYNFFKDDSLYYILNRIHNIVRP
FT                   SLELKHLKKNFIEYINSFCSLKFETFYKHKGNYKKEKMLRNILKTKKLSKRPEVIEEVK
FT                   KIEEEKKKQRLTKCDPLDDFDPVVNEFMIKEHFYS"
     MFFFSSKNKS FLLWASFMLI YFTNISIYVS KIHHHGLNKK IYNLNFVSNV FKYNARRRGN        60
     SLNVLINSPA QVKLSEMEDA KDRSGKYCII EICGKIRWVE EGRFYDVFRI KQEENRNIYL       120
     NRILFYSNEE GNIFFGRPFL DNVRIHATVL NHFRGHKIYR LKYKPKKNYK RFYGHRQEMT       180
     RIKINKIEYN NELLGQEKRI YNFFKDDSLY YILNRIHNIV RPSLELKHLK KNFIEYINSF       240
     CSLKFETFYK HKGNYKKEKM LRNILKTKKL SKRPEVIEEV KKIEEEKKKQ RLTKCDPLDD       300
     FDPVVNEFMI KEHFYS                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page