(data stored in ACNUC9543 zone)

EMBL: AL844507.PE271

AL844507.PE271       Location/Qualifiers
FT   CDS             complement(join(1187623..1188552,1188801..1192925))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0827600"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0827600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.18:mRNA"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBA8"
FT                   /protein_id="CAD51099.2"
FT                   /translation="MIFLILSIILFLLTYECKTIKKYFYVNNNINLLKDKKKNITYRLR
FT                   RNKRIYENGNDLFEYFITLKNEELEMHKEEKKKKNPHAVSYIQKLPKKKHLLRRWKYDL
FT                   FEKIKEKMKYEDETKRTTKLCRHKFKLPIDFFKLGDQVRAKVVHVQNHLIKVDINFIQL
FT                   AHLYIKRYFNEKAELKKKYEIGKYIDVVICYIHKKNNIIQVTDNEEEIKMLKFNLNKLR
FT                   EVGYLKRNYQHEKGEQKYDDKTYDDKTYDDKTYDDKTYDDKTYGDSEKYDEGEHFEGDE
FT                   NYKVKEKYNDYIECDDDNECDDDNECDDDNECDDYKDDEDIANNLTNTYQQSHVPNMTY
FT                   QQNIYKHNKNEEKIDEIKEKLGLQFQLNKDSQDLMYIKEENKKKKLKKITDFKIEDEVN
FT                   GTVKFINEEGAYIDIGCKTLAFLNLGHYNKDPNNFLNNRKKKKIEINDYIKNLKIRKID
FT                   ILNNRIEVSVYDMQGEACLRILNQQETLREQNKYIPCSSFITHNYHMINYIKKYNELKK
FT                   KKKNVYNLFEKNKQLDELRNVKDLKKEDFKSFILKYNELSSPNSNYQEMLEQNANNEQF
FT                   LKEIGTDVTNNENNQFNVDFLRKKNKELKNEIQIFRDNLYTPMNNNNNNNNNNNKQCTN
FT                   QTFDNHYMNNDKCHNDQDQNEYSISERYIYDQQDKYNTDEESINKMKEKLKYYDSLNID
FT                   NDMHNIEANEQNQSSLLYLKKNIHKIRRDVLEECNQNSHSEDRKRKNFQRQIEKDLLTL
FT                   KKYQMEDKNGVTKSSGHEQNDRGNYDDEKYDQYYDDEKYDQYYDDDEKYDQYYDDDEKY
FT                   DQYYDDDEKCGDKKYDKNYEKKKNSSHENVNDFLNRNSEKDNLFNKNEQLEEEDKLYDE
FT                   ELKKKIFENDPLDDDKNNEDEKSFFNIKNDLNYILSKNLNMNILNDEQKCIEEASKLFG
FT                   EDISKWDEKMYYYFGSKDNLSLDNVEIYDDYEFRNKLLNRNVENHFSEFDKILNIQNDK
FT                   MIQDDQQFLSAKYGDNVHKNDDEVMHKKKIINYNEEINNKHINHHTNKYDIIGEHINDE
FT                   SDQYDINDDDTTDDDIIYHQGNNNKNIKNKNNYNEIFEHDNYSPEDDKLKDTSLIHQQT
FT                   NNATKMNIHINNEHNENNEHNENNENNKNNEYNYDDDIENYLNTFINEENVQEHCVKSP
FT                   EQVRQKTNTPNKKVANLKKSELNENNDMQNYDMFENNVKELFYEDKKKKNEFVKDIYTI
FT                   LNDKMHSSENINVDQNNNQQHIDNNNNNNNNNLFSKEEQSKLEETTEINIQNIINKAIN
FT                   IGNLFKKNELHKLLKMKKKSNNDRMTPVKDPTNGNVLKINKMIKVEEQKKQEAMVEHNQ
FT                   NYQDNNHIDSFEKSYVKNEDDEMKAYRNASYELQGYYKRKRKMINMEELKDVQPEKEEG
FT                   LVLSNDDLINNKHNNDKNTSSYEKEMDNNNKSNKINNFLNVDMNKDMLFLYGQNEKIAE
FT                   DKFLEKLLEKEKHTNKAVSKDIDVLIQSYKYMNEHPDNFIEYFYKKNEQKTSSSNNNKE
FT                   KECIDTNGNNNVNHIINDNNYMNEFNYNANNKQHYYDNIPTYEENIPTHEENIPTHEEN
FT                   IPTHEENIPTHEENIPTDFNDFSNTTIALKTWSLKLGLIKEKHMHLNDQELINHFLKSE
FT                   KFKRALKFYNVNTKYVTIPLIYKITKLLYFERPFPSKEKYYKLNMN"
     MIFLILSIIL FLLTYECKTI KKYFYVNNNI NLLKDKKKNI TYRLRRNKRI YENGNDLFEY        60
     FITLKNEELE MHKEEKKKKN PHAVSYIQKL PKKKHLLRRW KYDLFEKIKE KMKYEDETKR       120
     TTKLCRHKFK LPIDFFKLGD QVRAKVVHVQ NHLIKVDINF IQLAHLYIKR YFNEKAELKK       180
     KYEIGKYIDV VICYIHKKNN IIQVTDNEEE IKMLKFNLNK LREVGYLKRN YQHEKGEQKY       240
     DDKTYDDKTY DDKTYDDKTY DDKTYGDSEK YDEGEHFEGD ENYKVKEKYN DYIECDDDNE       300
     CDDDNECDDD NECDDYKDDE DIANNLTNTY QQSHVPNMTY QQNIYKHNKN EEKIDEIKEK       360
     LGLQFQLNKD SQDLMYIKEE NKKKKLKKIT DFKIEDEVNG TVKFINEEGA YIDIGCKTLA       420
     FLNLGHYNKD PNNFLNNRKK KKIEINDYIK NLKIRKIDIL NNRIEVSVYD MQGEACLRIL       480
     NQQETLREQN KYIPCSSFIT HNYHMINYIK KYNELKKKKK NVYNLFEKNK QLDELRNVKD       540
     LKKEDFKSFI LKYNELSSPN SNYQEMLEQN ANNEQFLKEI GTDVTNNENN QFNVDFLRKK       600
     NKELKNEIQI FRDNLYTPMN NNNNNNNNNN KQCTNQTFDN HYMNNDKCHN DQDQNEYSIS       660
     ERYIYDQQDK YNTDEESINK MKEKLKYYDS LNIDNDMHNI EANEQNQSSL LYLKKNIHKI       720
     RRDVLEECNQ NSHSEDRKRK NFQRQIEKDL LTLKKYQMED KNGVTKSSGH EQNDRGNYDD       780
     EKYDQYYDDE KYDQYYDDDE KYDQYYDDDE KYDQYYDDDE KCGDKKYDKN YEKKKNSSHE       840
     NVNDFLNRNS EKDNLFNKNE QLEEEDKLYD EELKKKIFEN DPLDDDKNNE DEKSFFNIKN       900
     DLNYILSKNL NMNILNDEQK CIEEASKLFG EDISKWDEKM YYYFGSKDNL SLDNVEIYDD       960
     YEFRNKLLNR NVENHFSEFD KILNIQNDKM IQDDQQFLSA KYGDNVHKND DEVMHKKKII      1020
     NYNEEINNKH INHHTNKYDI IGEHINDESD QYDINDDDTT DDDIIYHQGN NNKNIKNKNN      1080
     YNEIFEHDNY SPEDDKLKDT SLIHQQTNNA TKMNIHINNE HNENNEHNEN NENNKNNEYN      1140
     YDDDIENYLN TFINEENVQE HCVKSPEQVR QKTNTPNKKV ANLKKSELNE NNDMQNYDMF      1200
     ENNVKELFYE DKKKKNEFVK DIYTILNDKM HSSENINVDQ NNNQQHIDNN NNNNNNNLFS      1260
     KEEQSKLEET TEINIQNIIN KAINIGNLFK KNELHKLLKM KKKSNNDRMT PVKDPTNGNV      1320
     LKINKMIKVE EQKKQEAMVE HNQNYQDNNH IDSFEKSYVK NEDDEMKAYR NASYELQGYY      1380
     KRKRKMINME ELKDVQPEKE EGLVLSNDDL INNKHNNDKN TSSYEKEMDN NNKSNKINNF      1440
     LNVDMNKDML FLYGQNEKIA EDKFLEKLLE KEKHTNKAVS KDIDVLIQSY KYMNEHPDNF      1500
     IEYFYKKNEQ KTSSSNNNKE KECIDTNGNN NVNHIINDNN YMNEFNYNAN NKQHYYDNIP      1560
     TYEENIPTHE ENIPTHEENI PTHEENIPTH EENIPTDFND FSNTTIALKT WSLKLGLIKE      1620
     KHMHLNDQEL INHFLKSEKF KRALKFYNVN TKYVTIPLIY KITKLLYFER PFPSKEKYYK      1680
     LNMN                                                                   1684
//

If you have problems or comments...

PBIL Back to PBIL home page