(data stored in ACNUC9543 zone)

EMBL: AL844507.PE273

AL844507.PE273       Location/Qualifiers
FT   CDS             1198858..1206057
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0827800"
FT                   /product="SET domain protein, putative"
FT                   /EC_number="2.1.1.43"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0827800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0012:mRNA"
FT                   /db_xref="GOA:Q8IBB0"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBB0"
FT                   /protein_id="CAD51097.1"
FT                   /translation="MLNDMNDKKDSIRNRNYKKNKKDEERNIRKYSNDNINVVNNMKDI
FT                   YNNNNNNINKSVIDCGNNLKRIEGKKVFERNKFGQFIKKSNSPSLKDTNIKSNNNKNMK
FT                   NTNHNNEENNNNNNTNNTLSNKEKIKVLIDKMKKIQNKKEVNKTLDKPMYIRNFQDEKK
FT                   VSTHNNAYKLKRNGDPRNYGDIKNGDNIKNGDNNKNGDNIKNGDNIKNGDNIKNGDNIK
FT                   NGDNIKNGDNIKNGDNIKNGDDQIIGCLKNNREPRSNVENETNEMSNSYGKFTKNRDLK
FT                   NSDKIKMNDEYRRNNDANISDYNKKNNNNNVNKSNNVVRSSDESLSSDTINKSDCKNKV
FT                   EENSSRNADESHKKEDGDLINKDKDEKEGENLSVPKESNETYYRISRRERCRNLKKEDN
FT                   LKIINDEDNSVSHFIKEGRKRSVRERSNLRNYNYINVNNNIKDDDFVDEPNNGSSIIKM
FT                   NERKKTILRRGARHRRRNPRKRGRRCSSLRNNRNTINSVTKSNYDMSDGDNYEKGRKFL
FT                   YDNSSNYNELDPLNSKFSNIKISKNFFLKMNDDEDEEDEDGVGDDDKTSKNSSYSFGFN
FT                   ERNIEKKIIILEQKDGIYEINENYLKYDNMKDMEDRKNMEDMKNMEDRKNMEDMKNMEY
FT                   MKNMEYMKNMEYMKNMEDMKNMEDMKNMEDMKNMEDMKNMEDMKNMEDDNKKDYMNDNL
FT                   KDDIVIKDNIVIKDDIVMKDNIVMKDNINDSVKDNINEELENNETSCKSSKLNDVTHNN
FT                   NNICDDNNIVSHSNGEMKEVNIMYPINNEINIKKKRILNNDEILILLNLLRDININRFN
FT                   IKHVMTSKDCMYEKFMLYNLFSYNITCLKSSLKMMYAYCLFKNLKLFYQIQYKNMNMTE
FT                   KSIPNYKIKNNLLDTHCIILSMFENYYENVSKQKMPIADFINSFYLNIHNINIGKKKVQ
FT                   PNKNYENIVLPEKDNRKITSMYTNKSLLYSNYMNKDINMENKAYKLNDINMENYRSDHK
FT                   NNTFIDNDCNNNHKYNNICKNELNSCISNISNDPNNNKNVHTMNKDLYGNIYTEQNAYH
FT                   VHNYKDMRNEHENNNNIKKKDNIENSIYYDNKMYLGANEKTPCLKDIHMNKNYEQTYDN
FT                   YDGTNGYNNNNKKKNDNKKNDNNNNDNNNNDNNNNDNQDDNHHDNNKEEYNNQNHLFLN
FT                   NESRKRKFFTNILPYKNKKKKLPYTINLNNDNKTYHHESINNENHMPLWDYKELENIKN
FT                   MINDEKDEEDCTPLAHSIKITKNYDNINMDECNVRNENQEYKDNVTNYKVCQDGNFECY
FT                   DVNESVLVRDIHMEKNNNVEKNNNDEKKNNDEKKNNDEKKNNDEKKNNDEKKNNDEKKN
FT                   NDEKNNDDNNNIIEKAKENIESIPYDKNCSQDNIQYNMAYKDTSLLLCEQRDMDKGNKK
FT                   EDDTIKMEDIHFSADMECSPMLKYRKRNYDNKNDDDYVKNDDDYVKDDDGCVKNDDGCI
FT                   KNDDGYIKNDDGYIKNDDGYIKNDDDYNNNGEYLHGSDNNLSAHKYNSVCRRRRRVDRN
FT                   KESNEKEKRVYRNDIMELENVDVMLLERIKKNYKMLIRNDNENKKKKKKNNGTVTILED
FT                   VDNVYDDNNNNNNDNNIDNNNNNNNNNNNNNNNNNVESHNNNNNERGSTKIEKCRKNKI
FT                   TFFNKYSKLLNNDNVDKKKSKYMLTTESLYNNNFNILDIKVNTHFAHNYHISLFFFCKY
FT                   TSYNLYLHPLNKNEHIVSYVILNSKNEVLTDNGNSFVLRYLLSFLTNKISSLRKCYANA
FT                   LYNSYLLQIPIRIFRHHNLENKYSPQYGIRYDGIYKIINAFTINDYSTPEYKRDILYVF
FT                   KRLYVDKCFIPNMNPKILDKQDKAERKKNFIEKNSVSINVMMNKEIIMTLRIPYLKNYK
FT                   STTFTNFNHIYKFIKKKCIQKKKAMPWIQSEVSIYEACMQHIKKTEEKKKEHFLNSQKM
FT                   NNIKTKVNNTNDIYNNENLNSGDDAFKDCIQAINVDKSVQQINDVRFDMNDGNYKMGDI
FT                   KKECSNVYENMFPAKNNNKIDINKININSNHFSNSSNNNNCDNYKRLGEPNFPYWCLGK
FT                   YLPFVLVLETLNFEKEIDIYKGIRTKNLKNLKISIIKTEIPINCEMAKRPAHLFIPIKS
FT                   KEAISAYIELKKPYDNHWNPYEDLSGGKEIFKIPVENVVDESLPPMNFTYVNKTIFFSR
FT                   LPPYNLLPLCSGCAPHNYNKKEYVDLYINGYCKGIRHKKTNRIYCDGNKNYDINDFNVL
FT                   AACSGNCLCDPLKCTNKFPEGLHYPIKVVKTKDIGWDIVSCSFIKANSLIMHYVGEITT
FT                   RKEMISREHEYDKKGYFNYFIETAEVDETYPDDWKIPCIDALFISNVARFLNHSCEPNV
FT                   NVITIWRGDNYPSVGIFASRDIQPNEPLKYHYGINYKNIKCMCASKKCKGYIG"
     MLNDMNDKKD SIRNRNYKKN KKDEERNIRK YSNDNINVVN NMKDIYNNNN NNINKSVIDC        60
     GNNLKRIEGK KVFERNKFGQ FIKKSNSPSL KDTNIKSNNN KNMKNTNHNN EENNNNNNTN       120
     NTLSNKEKIK VLIDKMKKIQ NKKEVNKTLD KPMYIRNFQD EKKVSTHNNA YKLKRNGDPR       180
     NYGDIKNGDN IKNGDNNKNG DNIKNGDNIK NGDNIKNGDN IKNGDNIKNG DNIKNGDNIK       240
     NGDDQIIGCL KNNREPRSNV ENETNEMSNS YGKFTKNRDL KNSDKIKMND EYRRNNDANI       300
     SDYNKKNNNN NVNKSNNVVR SSDESLSSDT INKSDCKNKV EENSSRNADE SHKKEDGDLI       360
     NKDKDEKEGE NLSVPKESNE TYYRISRRER CRNLKKEDNL KIINDEDNSV SHFIKEGRKR       420
     SVRERSNLRN YNYINVNNNI KDDDFVDEPN NGSSIIKMNE RKKTILRRGA RHRRRNPRKR       480
     GRRCSSLRNN RNTINSVTKS NYDMSDGDNY EKGRKFLYDN SSNYNELDPL NSKFSNIKIS       540
     KNFFLKMNDD EDEEDEDGVG DDDKTSKNSS YSFGFNERNI EKKIIILEQK DGIYEINENY       600
     LKYDNMKDME DRKNMEDMKN MEDRKNMEDM KNMEYMKNME YMKNMEYMKN MEDMKNMEDM       660
     KNMEDMKNME DMKNMEDMKN MEDDNKKDYM NDNLKDDIVI KDNIVIKDDI VMKDNIVMKD       720
     NINDSVKDNI NEELENNETS CKSSKLNDVT HNNNNICDDN NIVSHSNGEM KEVNIMYPIN       780
     NEINIKKKRI LNNDEILILL NLLRDININR FNIKHVMTSK DCMYEKFMLY NLFSYNITCL       840
     KSSLKMMYAY CLFKNLKLFY QIQYKNMNMT EKSIPNYKIK NNLLDTHCII LSMFENYYEN       900
     VSKQKMPIAD FINSFYLNIH NINIGKKKVQ PNKNYENIVL PEKDNRKITS MYTNKSLLYS       960
     NYMNKDINME NKAYKLNDIN MENYRSDHKN NTFIDNDCNN NHKYNNICKN ELNSCISNIS      1020
     NDPNNNKNVH TMNKDLYGNI YTEQNAYHVH NYKDMRNEHE NNNNIKKKDN IENSIYYDNK      1080
     MYLGANEKTP CLKDIHMNKN YEQTYDNYDG TNGYNNNNKK KNDNKKNDNN NNDNNNNDNN      1140
     NNDNQDDNHH DNNKEEYNNQ NHLFLNNESR KRKFFTNILP YKNKKKKLPY TINLNNDNKT      1200
     YHHESINNEN HMPLWDYKEL ENIKNMINDE KDEEDCTPLA HSIKITKNYD NINMDECNVR      1260
     NENQEYKDNV TNYKVCQDGN FECYDVNESV LVRDIHMEKN NNVEKNNNDE KKNNDEKKNN      1320
     DEKKNNDEKK NNDEKKNNDE KKNNDEKNND DNNNIIEKAK ENIESIPYDK NCSQDNIQYN      1380
     MAYKDTSLLL CEQRDMDKGN KKEDDTIKME DIHFSADMEC SPMLKYRKRN YDNKNDDDYV      1440
     KNDDDYVKDD DGCVKNDDGC IKNDDGYIKN DDGYIKNDDG YIKNDDDYNN NGEYLHGSDN      1500
     NLSAHKYNSV CRRRRRVDRN KESNEKEKRV YRNDIMELEN VDVMLLERIK KNYKMLIRND      1560
     NENKKKKKKN NGTVTILEDV DNVYDDNNNN NNDNNIDNNN NNNNNNNNNN NNNNVESHNN      1620
     NNNERGSTKI EKCRKNKITF FNKYSKLLNN DNVDKKKSKY MLTTESLYNN NFNILDIKVN      1680
     THFAHNYHIS LFFFCKYTSY NLYLHPLNKN EHIVSYVILN SKNEVLTDNG NSFVLRYLLS      1740
     FLTNKISSLR KCYANALYNS YLLQIPIRIF RHHNLENKYS PQYGIRYDGI YKIINAFTIN      1800
     DYSTPEYKRD ILYVFKRLYV DKCFIPNMNP KILDKQDKAE RKKNFIEKNS VSINVMMNKE      1860
     IIMTLRIPYL KNYKSTTFTN FNHIYKFIKK KCIQKKKAMP WIQSEVSIYE ACMQHIKKTE      1920
     EKKKEHFLNS QKMNNIKTKV NNTNDIYNNE NLNSGDDAFK DCIQAINVDK SVQQINDVRF      1980
     DMNDGNYKMG DIKKECSNVY ENMFPAKNNN KIDINKININ SNHFSNSSNN NNCDNYKRLG      2040
     EPNFPYWCLG KYLPFVLVLE TLNFEKEIDI YKGIRTKNLK NLKISIIKTE IPINCEMAKR      2100
     PAHLFIPIKS KEAISAYIEL KKPYDNHWNP YEDLSGGKEI FKIPVENVVD ESLPPMNFTY      2160
     VNKTIFFSRL PPYNLLPLCS GCAPHNYNKK EYVDLYINGY CKGIRHKKTN RIYCDGNKNY      2220
     DINDFNVLAA CSGNCLCDPL KCTNKFPEGL HYPIKVVKTK DIGWDIVSCS FIKANSLIMH      2280
     YVGEITTRKE MISREHEYDK KGYFNYFIET AEVDETYPDD WKIPCIDALF ISNVARFLNH      2340
     SCEPNVNVIT IWRGDNYPSV GIFASRDIQP NEPLKYHYGI NYKNIKCMCA SKKCKGYIG       2399
//

If you have problems or comments...

PBIL Back to PBIL home page