(data stored in ACNUC9543 zone)

EMBL: AL844507.PE276

AL844507.PE276       Location/Qualifiers
FT   CDS             complement(join(1212337..1213695,1213888..1215630))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0828100"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /protein_id="VWP74548.1"
FT                   /translation="MMFYKYYHYAKCRRFIHMVSSLEGTYINIERFICHCSNNFYFLKS
FT                   GSIYYNGDRRFINCDNVIIKEKQICKNKKRKTSTCYNNNNNNDDDDDKLSCENHINEDI
FT                   IVNHNVCNNNNMLHNIEDKHLKYEYIQEKMYELIKGNGCEKDKILMILDFICNDKFKNK
FT                   NDFLFFSTHLLMLSELYKDIIIINENIYNNSHIINYIKECINFMIISKKYSSLNSLFKY
FT                   FNLLCIFHINEIRLIQKIFYLILCNKQFNDIQEKVIYSYYIIQHLYNNHIFNKFISNLL
FT                   TNKLLLRINFVRFLQTQKDIKNNFLIFLYYIIHSLNNNTTNDIIIQMYVTYYNNMLQKN
FT                   IQSFKNIVNLNLINQLYYILLISQYYDLDLNMLIKKNIQTYLPFLNIYEIILACTNLLL
FT                   NFTKNDKILLYMIPYDESRKSKNQLMESKKNNNINDNNNNNNNNNNIHISNNSENGKTT
FT                   PFKKYYHNFLSMKYLCDSIIRSSDNYISSCNYNHNNEYIYMFLVLSSYCHFTLYLNWWA
FT                   DTTIYFKLKKKKKKKKKVLRSRLPYVFHLQEKIAHILDIILYNSSYSNESYIQTMGYQR
FT                   DYLNNEKFIGQDQTYGQLNENNPEQNNILSKCNNKKNRNIQNNLQYENTCSTPEQINYH
FT                   NSLIKCKANIVDIKYVTYIFKSFLRISLFNPGHLKNKKNFIQLLENSFINYVNRYIYNY
FT                   QKEDKNFNEINDTNHLIKRKETRGINGSSHNNVSIDNQKINVTYNMYDDKNSNLLYKEP
FT                   FHFNIYDNDLSLYELSSICECFFLVEYINSQDFQNINNIKVVKKKKNIQNNNAHRVEKE
FT                   KCVIFNSDDIFEKTLYIFLDKMNRFVCNKKLNLTTSNEDYIKNVLLEKFLNQGDIFFNY
FT                   YLLLRLLLPLLFSASLDHYILLSKRLIVHILSLIFHKKMKEQINKGIKNNILHITNVIN
FT                   DYMKWENSFIYINNQRRIRKQTKTKMNLLDFIYTGEFIRPSFILILIINELKNYDDMFD
FT                   QFIQNIFKNDANIKENKKDLTNYIDKMYKKMYALVIKKEKEGLL"
     MMFYKYYHYA KCRRFIHMVS SLEGTYINIE RFICHCSNNF YFLKSGSIYY NGDRRFINCD        60
     NVIIKEKQIC KNKKRKTSTC YNNNNNNDDD DDKLSCENHI NEDIIVNHNV CNNNNMLHNI       120
     EDKHLKYEYI QEKMYELIKG NGCEKDKILM ILDFICNDKF KNKNDFLFFS THLLMLSELY       180
     KDIIIINENI YNNSHIINYI KECINFMIIS KKYSSLNSLF KYFNLLCIFH INEIRLIQKI       240
     FYLILCNKQF NDIQEKVIYS YYIIQHLYNN HIFNKFISNL LTNKLLLRIN FVRFLQTQKD       300
     IKNNFLIFLY YIIHSLNNNT TNDIIIQMYV TYYNNMLQKN IQSFKNIVNL NLINQLYYIL       360
     LISQYYDLDL NMLIKKNIQT YLPFLNIYEI ILACTNLLLN FTKNDKILLY MIPYDESRKS       420
     KNQLMESKKN NNINDNNNNN NNNNNIHISN NSENGKTTPF KKYYHNFLSM KYLCDSIIRS       480
     SDNYISSCNY NHNNEYIYMF LVLSSYCHFT LYLNWWADTT IYFKLKKKKK KKKKVLRSRL       540
     PYVFHLQEKI AHILDIILYN SSYSNESYIQ TMGYQRDYLN NEKFIGQDQT YGQLNENNPE       600
     QNNILSKCNN KKNRNIQNNL QYENTCSTPE QINYHNSLIK CKANIVDIKY VTYIFKSFLR       660
     ISLFNPGHLK NKKNFIQLLE NSFINYVNRY IYNYQKEDKN FNEINDTNHL IKRKETRGIN       720
     GSSHNNVSID NQKINVTYNM YDDKNSNLLY KEPFHFNIYD NDLSLYELSS ICECFFLVEY       780
     INSQDFQNIN NIKVVKKKKN IQNNNAHRVE KEKCVIFNSD DIFEKTLYIF LDKMNRFVCN       840
     KKLNLTTSNE DYIKNVLLEK FLNQGDIFFN YYLLLRLLLP LLFSASLDHY ILLSKRLIVH       900
     ILSLIFHKKM KEQINKGIKN NILHITNVIN DYMKWENSFI YINNQRRIRK QTKTKMNLLD       960
     FIYTGEFIRP SFILILIINE LKNYDDMFDQ FIQNIFKNDA NIKENKKDLT NYIDKMYKKM      1020
     YALVIKKEKE GLL                                                         1033
//

If you have problems or comments...

PBIL Back to PBIL home page