(data stored in ACNUC9543 zone)

EMBL: AL844507.PE278

AL844507.PE278       Location/Qualifiers
FT   CDS             complement(1221025..1222683)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0828300"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0828300"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0010:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBB4"
FT                   /protein_id="CAD51092.1"
FT                   /translation="MEDQDNMNDSYYKNKEYEQENENFNINNEDEKKEENSFHQVTNVY
FT                   HSNVYINKNTKEDNIIRKYLSEQMTKVNIINNNHNIDDNNNNNNNNNELYINQVTNIDD
FT                   SDDDVPLLKTYGINHTINTKYEKNDNPFNNNNEEEEEKEKEKEKEHQPHQGNQINNDNN
FT                   SNQEKHGIFLSKQESSKLHTKYANQDNQKETSSSDTSSDDDVCLLNLIKNDKNYNINNF
FT                   NNQNYYEKKNNFKDDDNNNSSDYSSYDSDEPILIRSNLKNKINIQTNKLGNTSHYSNTC
FT                   MNNNNRYQTNKTKLINKKTTLKSSENKKDNKFKNINAKTSLSKISCRKTSKNSNDISKR
FT                   KKKTITKTKKKTKKQKKKQKKTKTKIKNKNKTNKHKDNKGNNHFNDNENDSICIGTFDP
FT                   RNRSNKEKLVAQLLIRWWYVLPDWPPPDYDYKDELYNRKLKLVPLEEYEDKEDIDSQGF
FT                   RKVYQISAFPGIFRDAMGIAYDLRDKDSCPCYNNLIKKTDQELLQLIYQAIKNQIQCLK
FT                   NSVYNETFMEKNLEKELKEVELKLNKITKKNIIKI"
     MEDQDNMNDS YYKNKEYEQE NENFNINNED EKKEENSFHQ VTNVYHSNVY INKNTKEDNI        60
     IRKYLSEQMT KVNIINNNHN IDDNNNNNNN NNELYINQVT NIDDSDDDVP LLKTYGINHT       120
     INTKYEKNDN PFNNNNEEEE EKEKEKEKEH QPHQGNQINN DNNSNQEKHG IFLSKQESSK       180
     LHTKYANQDN QKETSSSDTS SDDDVCLLNL IKNDKNYNIN NFNNQNYYEK KNNFKDDDNN       240
     NSSDYSSYDS DEPILIRSNL KNKINIQTNK LGNTSHYSNT CMNNNNRYQT NKTKLINKKT       300
     TLKSSENKKD NKFKNINAKT SLSKISCRKT SKNSNDISKR KKKTITKTKK KTKKQKKKQK       360
     KTKTKIKNKN KTNKHKDNKG NNHFNDNEND SICIGTFDPR NRSNKEKLVA QLLIRWWYVL       420
     PDWPPPDYDY KDELYNRKLK LVPLEEYEDK EDIDSQGFRK VYQISAFPGI FRDAMGIAYD       480
     LRDKDSCPCY NNLIKKTDQE LLQLIYQAIK NQIQCLKNSV YNETFMEKNL EKELKEVELK       540
     LNKITKKNII KI                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page