(data stored in SCRATCH zone)

EMBL: AL844507.PE279

AL844507.PE279       Location/Qualifiers
FT   CDS             complement(1224094..1225863)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0828400"
FT                   /product="mitochondrial inner membrane protein OXA1,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0828400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.14:mRNA"
FT                   /db_xref="GOA:Q8IBB5"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBB5"
FT                   /protein_id="CAD51091.1"
FT                   /translation="MFQQNNSLKCNFNIIFHHISFRTNKGEWTKGLSTNPNKINQIENN
FT                   KSNINNTYYHIYQYDKSILVNKFIQMYIKMGYIKNKKNKISIKQNNNIYNKHNINNIYN
FT                   KHNINNIYNIYNIYYNTFICSTNNVRNKQSFCNNNVHDKFGGLALFSRFFFTMPINNIN
FT                   NYFNKQHNDKNINDKFDTSHCEEDPDKGVSKNIDHLKREDEHGKALTNKEMNNNNNNNN
FT                   NNDDNIYNDDNVYNDDNNYNDGNIYNNNNDYAYNNKSNEGSTYPLNEEETNVNLTEDIY
FT                   PYTDFIIEKCKLNIKSDVDIYENTWYVKLIYDLLNSTKLFFDCTWMSSIIMTTLFMRII
FT                   ILPLTISSERDRRKQKILSPLLKELTKKLKDNAQDGNIKKAVEFKKKILNIRNTHGISL
FT                   IPKSIILMAFFQTPLFFIFYFSMKRIASYPDIFKDFTFESPLWLDSLSLPDPYYILPIL
FT                   SSLLLLSNNELTLLIDKKINENNKQSNLNNQEETEFQKNMKKITKLAMRLFYLSSVLFF
FT                   KSMPSGLFIYFITNTFFQLFITQICKIKIIENFLDLPPLHSKGFITSTNTSQQQTTSQK
FT                   KIIHMNDLIKRKK"
     MFQQNNSLKC NFNIIFHHIS FRTNKGEWTK GLSTNPNKIN QIENNKSNIN NTYYHIYQYD        60
     KSILVNKFIQ MYIKMGYIKN KKNKISIKQN NNIYNKHNIN NIYNKHNINN IYNIYNIYYN       120
     TFICSTNNVR NKQSFCNNNV HDKFGGLALF SRFFFTMPIN NINNYFNKQH NDKNINDKFD       180
     TSHCEEDPDK GVSKNIDHLK REDEHGKALT NKEMNNNNNN NNNNDDNIYN DDNVYNDDNN       240
     YNDGNIYNNN NDYAYNNKSN EGSTYPLNEE ETNVNLTEDI YPYTDFIIEK CKLNIKSDVD       300
     IYENTWYVKL IYDLLNSTKL FFDCTWMSSI IMTTLFMRII ILPLTISSER DRRKQKILSP       360
     LLKELTKKLK DNAQDGNIKK AVEFKKKILN IRNTHGISLI PKSIILMAFF QTPLFFIFYF       420
     SMKRIASYPD IFKDFTFESP LWLDSLSLPD PYYILPILSS LLLLSNNELT LLIDKKINEN       480
     NKQSNLNNQE ETEFQKNMKK ITKLAMRLFY LSSVLFFKSM PSGLFIYFIT NTFFQLFITQ       540
     ICKIKIIENF LDLPPLHSKG FITSTNTSQQ QTTSQKKIIH MNDLIKRKK                   589
//

If you have problems or comments...

PBIL Back to PBIL home page