(data stored in ACNUC9543 zone)

EMBL: AL844507.PE280

AL844507.PE280       Location/Qualifiers
FT   CDS             complement(join(1226750..1227436,1227738..1227951,
FT                   1228089..1228164,1228358..1228409))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0828500"
FT                   /product="translation initiation factor eIF-2B subunit
FT                   alpha, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0828500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0009:mRNA"
FT                   /db_xref="GOA:Q8IBB6"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042528"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBB6"
FT                   /protein_id="CAD51090.1"
FT                   /translation="MECYDNTKQKDLQEEHDVVRNFRRYYFQEKEEMHIAAIKSISDVL
FT                   KNSISETNFELFINMNEAKCKLNNFINNNQTQQDIISVPHSKRMTIYPIISSCDIYHHF
FT                   VVKKYTHNENNFHVLKNVIENNADEFSASLQKSLETIGSSSNIMFLNKHTTILTHSNSD
FT                   CVKSLIMDVVKNQNKQVSIYFTCTSQVNLNYEEKEKKFDENFLEELNKENINITKIDLT
FT                   QVKDIINKIDFVLIGSEIVTDNGGIINKKGIKLISELCLLYKKPFYVTCQAYKFLKIDK
FT                   NKCSKDFYTFCTQTVTNNFNNIYEFVSPDFITLFYTDIGIFPPSNISYELSKLYINDAF
FT                   YF"
     MECYDNTKQK DLQEEHDVVR NFRRYYFQEK EEMHIAAIKS ISDVLKNSIS ETNFELFINM        60
     NEAKCKLNNF INNNQTQQDI ISVPHSKRMT IYPIISSCDI YHHFVVKKYT HNENNFHVLK       120
     NVIENNADEF SASLQKSLET IGSSSNIMFL NKHTTILTHS NSDCVKSLIM DVVKNQNKQV       180
     SIYFTCTSQV NLNYEEKEKK FDENFLEELN KENINITKID LTQVKDIINK IDFVLIGSEI       240
     VTDNGGIINK KGIKLISELC LLYKKPFYVT CQAYKFLKID KNKCSKDFYT FCTQTVTNNF       300
     NNIYEFVSPD FITLFYTDIG IFPPSNISYE LSKLYINDAF YF                          342
//

If you have problems or comments...

PBIL Back to PBIL home page