(data stored in ACNUC9543 zone)

EMBL: AL844507.PE282

AL844507.PE282       Location/Qualifiers
FT   CDS             1233372..1236473
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0828700"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0828700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.12:mRNA"
FT                   /db_xref="GOA:Q8IBB8"
FT                   /db_xref="InterPro:IPR033290"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8IBB8"
FT                   /protein_id="CAD51088.1"
FT                   /translation="MSEESFDDTNKAFENEKDIILEKIVKDENNLNNCSNMINMDDVEN
FT                   MKKELYVLHKKDEEIENNVDCFSGDKYNVENVINLKKKKKKDEDTDSSYYKTTLDEVYD
FT                   TSDISTDEMLSNYSSSEDNNNIEMNIINDFYLKDDNTYCLEWNSDIINVLSEEIKEKEK
FT                   LLEDENKDICNMKSRFLKLEKYVNIKKKKIINIKKNIEEKRKIEFDEKEIFKCLQIKND
FT                   FLKKENKKIELEREKNNKKIIETQNNITTCQKNIDDIKKELILKENELNDFINKIKIIQ
FT                   QEEYEIEKIKLSKDKEIQNVSYNLEKYNNEKIQQDKKYEQVKMNNMKFDIELKSIIQEY
FT                   YDIKKDIKNISNKYICIMDMIKCRDKTIYKFEKDYTKTIHKEKQLQNKCLHKQNLINTQ
FT                   KDKNIILNNQIKKIQFDINKIRKELNDKQMSYDKTIIDRDHLNKEYEYEIVEIKEKLQE
FT                   EKKSLENTLQHLNETYITMSTNYEESKNEYEKEQVNNIEKNDLIKSSEQILVQLQNKLQ
FT                   KLLDEIKSLDLEKFQLTQTLQVIKNDYITLEADVLGTQIKIKQIKSNIKKTEKELERQK
FT                   EMLYKFDFQTQVLTKKINMISGISTFEKKKENQKKIILLEKELYKNEDIYNTLNNEMKR
FT                   INIEIKNIKLYQNELQEQKMNYKNLYEKLQLEIKSLESTINNEIKEKENIMLIELNLKI
FT                   ELDKLKSTFSKHVDNLNICKKEKKENMNNAKLSEQDINAHMESLKVIIKNINDEIHKLN
FT                   IQLYEKKNKSNNLQLKLNSIIICNQKNKDQKDICPNENQHIYYKMKIDQDIINLKEQLK
FT                   KINEQIDKENIETKNFQRTLDDIIQTNKEFNDNIKSIDPQYKILLKKKNKLNKKWEQIN
FT                   DHINNLETNINDYNKKIKEGDSQLNNIQLQCENIEQKINKIKESNLKVENNINDLFIKI
FT                   ERASNQLKKNLAPTTNMMKLKNKQIKDDENNLSNNNNNNNNNNNNINVNVNVNCEPVPL
FT                   EKHIFKQIQMESLKEKLSLLMECFKNNIDNVIMKEVFNLIETAE"
     MSEESFDDTN KAFENEKDII LEKIVKDENN LNNCSNMINM DDVENMKKEL YVLHKKDEEI        60
     ENNVDCFSGD KYNVENVINL KKKKKKDEDT DSSYYKTTLD EVYDTSDIST DEMLSNYSSS       120
     EDNNNIEMNI INDFYLKDDN TYCLEWNSDI INVLSEEIKE KEKLLEDENK DICNMKSRFL       180
     KLEKYVNIKK KKIINIKKNI EEKRKIEFDE KEIFKCLQIK NDFLKKENKK IELEREKNNK       240
     KIIETQNNIT TCQKNIDDIK KELILKENEL NDFINKIKII QQEEYEIEKI KLSKDKEIQN       300
     VSYNLEKYNN EKIQQDKKYE QVKMNNMKFD IELKSIIQEY YDIKKDIKNI SNKYICIMDM       360
     IKCRDKTIYK FEKDYTKTIH KEKQLQNKCL HKQNLINTQK DKNIILNNQI KKIQFDINKI       420
     RKELNDKQMS YDKTIIDRDH LNKEYEYEIV EIKEKLQEEK KSLENTLQHL NETYITMSTN       480
     YEESKNEYEK EQVNNIEKND LIKSSEQILV QLQNKLQKLL DEIKSLDLEK FQLTQTLQVI       540
     KNDYITLEAD VLGTQIKIKQ IKSNIKKTEK ELERQKEMLY KFDFQTQVLT KKINMISGIS       600
     TFEKKKENQK KIILLEKELY KNEDIYNTLN NEMKRINIEI KNIKLYQNEL QEQKMNYKNL       660
     YEKLQLEIKS LESTINNEIK EKENIMLIEL NLKIELDKLK STFSKHVDNL NICKKEKKEN       720
     MNNAKLSEQD INAHMESLKV IIKNINDEIH KLNIQLYEKK NKSNNLQLKL NSIIICNQKN       780
     KDQKDICPNE NQHIYYKMKI DQDIINLKEQ LKKINEQIDK ENIETKNFQR TLDDIIQTNK       840
     EFNDNIKSID PQYKILLKKK NKLNKKWEQI NDHINNLETN INDYNKKIKE GDSQLNNIQL       900
     QCENIEQKIN KIKESNLKVE NNINDLFIKI ERASNQLKKN LAPTTNMMKL KNKQIKDDEN       960
     NLSNNNNNNN NNNNNINVNV NVNCEPVPLE KHIFKQIQME SLKEKLSLLM ECFKNNIDNV      1020
     IMKEVFNLIE TAE                                                         1033
//

If you have problems or comments...

PBIL Back to PBIL home page