(data stored in ACNUC9543 zone)

EMBL: AL844507.PE283

AL844507.PE283       Location/Qualifiers
FT   CDS             complement(1237285..1239501)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0828800"
FT                   /product="GPI-anchored micronemal antigen"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0828800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0008:mRNA"
FT                   /db_xref="GOA:Q8IBB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBB9"
FT                   /protein_id="CAD51087.1"
FT                   /translation="MKYYTSLYVALIIALCQAVSALIRNSNTPQAFLIPELNNNEKNEF
FT                   NNNEKNEMNNNLNNEFNNNEENCDIQKIAEEMMENLLNENDMYTNIMLSLQNRLSDDYL
FT                   CSEPKYENICIHEKDKISLSFPCSNPKYEKLIHKFTFKKLCNSKAAFNNTLLKSFIEED
FT                   EEQNTFSLMLKQFKILLTCVDDELKDIYKESIDLLVDLKTSITELTQKLWSGKMVNVLK
FT                   KREFLITGILCELRNGNKSPLISKSLEFENLGILKMNNEELLNEAYNAFSDYYYFFPYF
FT                   IQKLLEKGGMIERLIKIHENLTKYRTKDMVNKINAQSKGEVLNNEDILNKLNAYKHYTK
FT                   HGATSFIQSREVKIVNQNVNNDDTTKNQQQNVNNNEKLNNNNNNNNNQQVNNNNNNNNQ
FT                   QVNNNNNNNNNQVNNNNNNNNNQVNNNNYNNNNQVNNNNNNNQQVNNNNNYNNQLNNNN
FT                   FNNNLQVNKNDKHVPKNNHTTATHTNNILYNPLYSINPEKPKDIIKLLKDLIKYLHIVK
FT                   FENNEPTTNIDEEGIRKLLENSFFDLNDDILIVRLLLKPQTVILTVIQSFMLMTPSPSR
FT                   DAKAYCKKALINDQLVPTNDTNILSEENELVNNFSTKYVLIYEKMKLQELKEMEESKLK
FT                   MKYSKTNLSALQVTNPQNNKDKNDASNKNNNPNNSSTPLIAVVTDLSGEKTEDIINNNV
FT                   DIATLSVGVQNTFQGPNAKAGSLINHLSYATFLFFSFILINLLN"
     MKYYTSLYVA LIIALCQAVS ALIRNSNTPQ AFLIPELNNN EKNEFNNNEK NEMNNNLNNE        60
     FNNNEENCDI QKIAEEMMEN LLNENDMYTN IMLSLQNRLS DDYLCSEPKY ENICIHEKDK       120
     ISLSFPCSNP KYEKLIHKFT FKKLCNSKAA FNNTLLKSFI EEDEEQNTFS LMLKQFKILL       180
     TCVDDELKDI YKESIDLLVD LKTSITELTQ KLWSGKMVNV LKKREFLITG ILCELRNGNK       240
     SPLISKSLEF ENLGILKMNN EELLNEAYNA FSDYYYFFPY FIQKLLEKGG MIERLIKIHE       300
     NLTKYRTKDM VNKINAQSKG EVLNNEDILN KLNAYKHYTK HGATSFIQSR EVKIVNQNVN       360
     NDDTTKNQQQ NVNNNEKLNN NNNNNNNQQV NNNNNNNNQQ VNNNNNNNNN QVNNNNNNNN       420
     NQVNNNNYNN NNQVNNNNNN NQQVNNNNNY NNQLNNNNFN NNLQVNKNDK HVPKNNHTTA       480
     THTNNILYNP LYSINPEKPK DIIKLLKDLI KYLHIVKFEN NEPTTNIDEE GIRKLLENSF       540
     FDLNDDILIV RLLLKPQTVI LTVIQSFMLM TPSPSRDAKA YCKKALINDQ LVPTNDTNIL       600
     SEENELVNNF STKYVLIYEK MKLQELKEME ESKLKMKYSK TNLSALQVTN PQNNKDKNDA       660
     SNKNNNPNNS STPLIAVVTD LSGEKTEDII NNNVDIATLS VGVQNTFQGP NAKAGSLINH       720
     LSYATFLFFS FILINLLN                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page