(data stored in ACNUC9543 zone)

EMBL: AL844507.PE284

AL844507.PE284       Location/Qualifiers
FT   CDS             complement(join(1241966..1242297,1242439..1242588,
FT                   1242700..1242720,1242841..1242895))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0828900"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0828900"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0007:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBC0"
FT                   /protein_id="CAD51086.1"
FT                   /translation="METENVPLENEENQNENYEQEENTLAQEAEIVLITTSLGGIKSSF
FT                   FSSLRAHQLLNCKKYIYFSIDANRDTSSAKNLKDIELFNKWKKGMILLSNENGIVLPQI
FT                   LIDGVPLGNDVTLQNLEDEGILDYIIARLKCPNCLIDKSNIEERCPGCKKYYVTLITDD
FT                   LIQNDSVIRILQGEPYKEPENE"
     METENVPLEN EENQNENYEQ EENTLAQEAE IVLITTSLGG IKSSFFSSLR AHQLLNCKKY        60
     IYFSIDANRD TSSAKNLKDI ELFNKWKKGM ILLSNENGIV LPQILIDGVP LGNDVTLQNL       120
     EDEGILDYII ARLKCPNCLI DKSNIEERCP GCKKYYVTLI TDDLIQNDSV IRILQGEPYK       180
     EPENE                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page