(data stored in ACNUC9543 zone)

EMBL: AL844507.PE285

AL844507.PE285       Location/Qualifiers
FT   CDS             join(1245211..1247381,1247526..1251078)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0829000"
FT                   /product="conserved Plasmodium membrane protein, unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0829000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.11:mRNA"
FT                   /db_xref="GOA:Q8IBC1"
FT                   /db_xref="InterPro:IPR033031"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBC1"
FT                   /protein_id="CAD51085.2"
FT                   /translation="MDLYQEEIYNRANVNVSVIVHDNIKDVIIKNLENNMTDKNIIINN
FT                   YNYNDITKINNIPKDNVNDEEKGILSLWLKKIKVVSSVIILCVDWQHIYSQQNTQSNSK
FT                   DNILKENKNTERKGSYIRKESIINEGIHKMGDMNCYDKIHGYGNVDNYGNIDNNINIDK
FT                   YSNVNNYNNTDGYNNNIDGYNNNIDDYNNNTDGYNNNIDGYNNNIDGYNNNIDGYNNNT
FT                   NDYNNNTNDYNNNTDDYNKPNSSSNIYNFHNMNNSYGDINMDDNNFCFVQNEEYMNKIN
FT                   KELLNRIEEINKIILKRKKVCKIILLVILPENTKNTEDYIKHISLLNCENISAIFITLG
FT                   LKEIHNKIKKLDNLLKDCVTTFFKQYIITYERKSNINLLSFFKYNFKKAYILEMLEKYD
FT                   ESMKIYVNLCKVFYEHIGDNVFSDLLQYFNYVIFFNCVSIRMIYIYLYFKDIKKSIHHI
FT                   YTHNKIIELTLIKNEPMLNEEENKMCVEDFFNIFNIYNEKKENKFFVNQIKYKKNDHVH
FT                   NNNSYYDDEEKLLLLSNINKLKEKNIDILLLLYNKILKEYLYYNLLSCVYFYFYRIIKN
FT                   FQIYIQDIVLYGIYCCFFIYNKIKAVKKKDNLIENFPHSYIIYFKMDSISFLYDFILNF
FT                   LIELFRIIKINEINSLSLIILYFLCTIYYEQKKYLFCAFLLLEFFTHPKDDFILNWLDV
FT                   QYLKDEKYDEGLFLCSLRKFKEDMECKRRRNNVAYEPLVYLLLNSLGFLLYHENIKMDV
FT                   QDDQKELQFFNVDKKEYETLFVEICFDYLNILIRNKKNNEKEDFTKFLRNYFDMVKCNL
FT                   YMNKDINLCLYNINVDMFYVFFESDSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
FT                   NNNLYAFLEIKDKYLHEHDYNNFIFLPFFVISINDDKKYFTYVHDDTFDDTTFCFCIDS
FT                   NEEDMINKLNLDIHNVKNRKINDNIQHNDSYLCKYMDRTKKMVVSFIISEWKNEMNVDY
FT                   VELYLFIFNQLIRIRVNKIYVSHFKKKYMKLCNDEKKKGGSKNQYDDNFVVNSVDVNSV
FT                   DVNSVDVNSVDVNSVYDSSYEENTHGINNNNNNNNNNNNSNNNSNNKNYSNNSHNINYK
FT                   KEIKQIDDKCSFGHVLNTFNKYDINNAEEKKIFPIKNTNSLRKNKIDYYKLKDGIYINK
FT                   YENKIIYNKDKYLYKKSLLKYVNYYIYTRNDKLYLNEYNISYIFIKYSTYIENFELNFS
FT                   FVIDDMDHVDFYLLSNENNVISIHKIKNRQNISLRGRKGMYKWYNNHADNIVLNNDKKV
FT                   KEKEKKENYIYIDDGNETEDNSNSNSSLSSDTEEYNSYSDDNNNVDNNLINHHHHNNDN
FT                   NTKEELEISDSFYKLINQNVHNNMYDDKQVLFDENIFFFEIEGDKKMKNNIKKSSVKKK
FT                   IHGRSNFNNNCFMLYEQWKIKMRKQRNKEDEYDEKKIGYNDNINLSNGYISNTFFSFYK
FT                   DKKEKLLCIPFIIRPRDLKNVRINFEFLFKNIYFKDELKYVLNYFVEPSLITIVTRMNM
FT                   RKDDEENDLINNEGEDNIQEGIISSQHNDTIKENISNNILDKDLFFYISYYLYIHNNNI
FT                   NKIHLVDIENIKIDNIIKMEYKNTYCDFLKTNKKHLYIKYQLNYGSMFFPFNIIFKKLI
FT                   FTNLIKLPYEDYIESINNKINLQNEHKKSKIKIDLIYSKIVKCNELFTIEAVITNKTNI
FT                   TEEVIIFLYDLPKEKEKVKKKKKKKLASQNKVKRKSQMSITYDEKKIYEYNEINKNNDN
FT                   INNDNINNVNIDNYNTNNYNVNKRNTFFNTPDYESSSDDYTSCSSSYSSYDMEYLINQD
FT                   EYLLDDENGDATRNELHMNNILNNVSEKKYIISGIRSMKNILLPYQTLHIHWSFIPLTY
FT                   GLITLPNVLIKRKTKVKNNVNVFASKDIQIIVI"
     MDLYQEEIYN RANVNVSVIV HDNIKDVIIK NLENNMTDKN IIINNYNYND ITKINNIPKD        60
     NVNDEEKGIL SLWLKKIKVV SSVIILCVDW QHIYSQQNTQ SNSKDNILKE NKNTERKGSY       120
     IRKESIINEG IHKMGDMNCY DKIHGYGNVD NYGNIDNNIN IDKYSNVNNY NNTDGYNNNI       180
     DGYNNNIDDY NNNTDGYNNN IDGYNNNIDG YNNNIDGYNN NTNDYNNNTN DYNNNTDDYN       240
     KPNSSSNIYN FHNMNNSYGD INMDDNNFCF VQNEEYMNKI NKELLNRIEE INKIILKRKK       300
     VCKIILLVIL PENTKNTEDY IKHISLLNCE NISAIFITLG LKEIHNKIKK LDNLLKDCVT       360
     TFFKQYIITY ERKSNINLLS FFKYNFKKAY ILEMLEKYDE SMKIYVNLCK VFYEHIGDNV       420
     FSDLLQYFNY VIFFNCVSIR MIYIYLYFKD IKKSIHHIYT HNKIIELTLI KNEPMLNEEE       480
     NKMCVEDFFN IFNIYNEKKE NKFFVNQIKY KKNDHVHNNN SYYDDEEKLL LLSNINKLKE       540
     KNIDILLLLY NKILKEYLYY NLLSCVYFYF YRIIKNFQIY IQDIVLYGIY CCFFIYNKIK       600
     AVKKKDNLIE NFPHSYIIYF KMDSISFLYD FILNFLIELF RIIKINEINS LSLIILYFLC       660
     TIYYEQKKYL FCAFLLLEFF THPKDDFILN WLDVQYLKDE KYDEGLFLCS LRKFKEDMEC       720
     KRRRNNVAYE PLVYLLLNSL GFLLYHENIK MDVQDDQKEL QFFNVDKKEY ETLFVEICFD       780
     YLNILIRNKK NNEKEDFTKF LRNYFDMVKC NLYMNKDINL CLYNINVDMF YVFFESDSNN       840
     NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNLYAFLE IKDKYLHEHD YNNFIFLPFF       900
     VISINDDKKY FTYVHDDTFD DTTFCFCIDS NEEDMINKLN LDIHNVKNRK INDNIQHNDS       960
     YLCKYMDRTK KMVVSFIISE WKNEMNVDYV ELYLFIFNQL IRIRVNKIYV SHFKKKYMKL      1020
     CNDEKKKGGS KNQYDDNFVV NSVDVNSVDV NSVDVNSVDV NSVYDSSYEE NTHGINNNNN      1080
     NNNNNNNSNN NSNNKNYSNN SHNINYKKEI KQIDDKCSFG HVLNTFNKYD INNAEEKKIF      1140
     PIKNTNSLRK NKIDYYKLKD GIYINKYENK IIYNKDKYLY KKSLLKYVNY YIYTRNDKLY      1200
     LNEYNISYIF IKYSTYIENF ELNFSFVIDD MDHVDFYLLS NENNVISIHK IKNRQNISLR      1260
     GRKGMYKWYN NHADNIVLNN DKKVKEKEKK ENYIYIDDGN ETEDNSNSNS SLSSDTEEYN      1320
     SYSDDNNNVD NNLINHHHHN NDNNTKEELE ISDSFYKLIN QNVHNNMYDD KQVLFDENIF      1380
     FFEIEGDKKM KNNIKKSSVK KKIHGRSNFN NNCFMLYEQW KIKMRKQRNK EDEYDEKKIG      1440
     YNDNINLSNG YISNTFFSFY KDKKEKLLCI PFIIRPRDLK NVRINFEFLF KNIYFKDELK      1500
     YVLNYFVEPS LITIVTRMNM RKDDEENDLI NNEGEDNIQE GIISSQHNDT IKENISNNIL      1560
     DKDLFFYISY YLYIHNNNIN KIHLVDIENI KIDNIIKMEY KNTYCDFLKT NKKHLYIKYQ      1620
     LNYGSMFFPF NIIFKKLIFT NLIKLPYEDY IESINNKINL QNEHKKSKIK IDLIYSKIVK      1680
     CNELFTIEAV ITNKTNITEE VIIFLYDLPK EKEKVKKKKK KKLASQNKVK RKSQMSITYD      1740
     EKKIYEYNEI NKNNDNINND NINNVNIDNY NTNNYNVNKR NTFFNTPDYE SSSDDYTSCS      1800
     SSYSSYDMEY LINQDEYLLD DENGDATRNE LHMNNILNNV SEKKYIISGI RSMKNILLPY      1860
     QTLHIHWSFI PLTYGLITLP NVLIKRKTKV KNNVNVFASK DIQIIVI                    1907
//

If you have problems or comments...

PBIL Back to PBIL home page