(data stored in ACNUC9543 zone)

EMBL: AL844507.PE288

AL844507.PE288       Location/Qualifiers
FT   CDS             join(1256555..1256588,1256680..1256842,1256938..1257016,
FT                   1257122..1257133)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0829300"
FT                   /product="U6 snRNA-associated Sm-like protein LSm8,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0829300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.9:mRNA"
FT                   /db_xref="GOA:C0H4Y9"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR034103"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Y9"
FT                   /protein_id="CAX64164.1"
FT                   /translation="MSSINIESYLENEILVITNDSRIFTGKLKGFDQTTNIILGNCHER
FT                   IYKESMEKISLGVYIIRGDTVTLIGEIDEDVDKNILHQKIKPQMLKPIVH"
     MSSINIESYL ENEILVITND SRIFTGKLKG FDQTTNIILG NCHERIYKES MEKISLGVYI        60
     IRGDTVTLIG EIDEDVDKNI LHQKIKPQML KPIVH                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page