(data stored in ACNUC9543 zone)

EMBL: AL844507.PE289

AL844507.PE289       Location/Qualifiers
FT   CDS             complement(1257716..1259041)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0829400"
FT                   /product="prolyl 4-hydroxylase subunit alpha, putative"
FT                   /EC_number="1.14.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0829400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.8:mRNA"
FT                   /db_xref="GOA:C0H4Z0"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Z0"
FT                   /protein_id="CAX64165.1"
FT                   /translation="MDVKKTIIKCSSPREFTNLDNSKKNEELLKNGKEDFNVHLYDNEI
FT                   KYSDDMQTIINKVINEKNIHFYKKYSSYLLYLSNEKQINDSEGDDSYTNDENTKVFFKI
FT                   QLNPQDMSIIYNIVDKKTIEKILSLCANKYKRSKTSIGYSNEKQEQYKLTNSINRTSST
FT                   VFLYTLRSRSVIEENQIDEDSSIVYTKDENIIELENTICNLVKIPLCYLEPLAIVKYEK
FT                   NNYFNLHHDGSFRRATLLIYLNDVDKDGETIFPCHNLSIKPIQGSGVFWYNNISIDDDY
FT                   AITYCTNKINQITYEEQNNKYHHILDENNNSSVFRTDSAKVYYPSSYSNTQEQPTTYFH
FT                   NSFQDASFIKNNTTTNNTHTNTNETSSQNTNSNHVLKKKKDLIIFLNDKNNLHKYSIDL
FT                   VYDELGNTYIADMTMVHQANRVTEQYKYVINCFFNVNIVRNI"
     MDVKKTIIKC SSPREFTNLD NSKKNEELLK NGKEDFNVHL YDNEIKYSDD MQTIINKVIN        60
     EKNIHFYKKY SSYLLYLSNE KQINDSEGDD SYTNDENTKV FFKIQLNPQD MSIIYNIVDK       120
     KTIEKILSLC ANKYKRSKTS IGYSNEKQEQ YKLTNSINRT SSTVFLYTLR SRSVIEENQI       180
     DEDSSIVYTK DENIIELENT ICNLVKIPLC YLEPLAIVKY EKNNYFNLHH DGSFRRATLL       240
     IYLNDVDKDG ETIFPCHNLS IKPIQGSGVF WYNNISIDDD YAITYCTNKI NQITYEEQNN       300
     KYHHILDENN NSSVFRTDSA KVYYPSSYSN TQEQPTTYFH NSFQDASFIK NNTTTNNTHT       360
     NTNETSSQNT NSNHVLKKKK DLIIFLNDKN NLHKYSIDLV YDELGNTYIA DMTMVHQANR       420
     VTEQYKYVIN CFFNVNIVRN I                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page