(data stored in ACNUC9543 zone)

EMBL: AL844507.PE291

AL844507.PE291       Location/Qualifiers
FT   CDS             1269135..1269647
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0829600"
FT                   /product="early transcribed membrane protein 8"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0829600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.6:mRNA"
FT                   /db_xref="GOA:C0H4Z2"
FT                   /db_xref="InterPro:IPR006389"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Z2"
FT                   /protein_id="CAX64167.1"
FT                   /translation="MKVFIFFAFVNFLFVLNLFSPCTCKKDYGKEWVKDKLSLVNLKLE
FT                   KYDKKKKFALISGAAIGALALITLIGGIYMTKGRKSSIWHNSEINDTLYDVVLETVNQG
FT                   NTDVKLAFQRGVKLDDAVPSEATFKKYLKQNIKDRNLNLTWQEERELYRMLPYIRFNVE
FT                   RLAVFLR"
     MKVFIFFAFV NFLFVLNLFS PCTCKKDYGK EWVKDKLSLV NLKLEKYDKK KKFALISGAA        60
     IGALALITLI GGIYMTKGRK SSIWHNSEIN DTLYDVVLET VNQGNTDVKL AFQRGVKLDD       120
     AVPSEATFKK YLKQNIKDRN LNLTWQEERE LYRMLPYIRF NVERLAVFLR                  170
//

If you have problems or comments...

PBIL Back to PBIL home page