(data stored in ACNUC9543 zone)

EMBL: AL844507.PE293

AL844507.PE293       Location/Qualifiers
FT   CDS             join(1294022..1294193,1294481..1294722)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0830400"
FT                   /product="CRA domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0830400"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0004:mRNA"
FT                   /db_xref="GOA:Q8IBD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBD0"
FT                   /protein_id="CAD51076.1"
FT                   /translation="MKNKLSTLFFITIFLILIFIDSAKGDERKNFWKSRFTAGRGNITN
FT                   KPTEVNHPIKKEGENFLSVGKGDHDESRVMLLKELYQKDNELNIVRKKHKKYKSITVAL
FT                   ASIIGMMLLRNIGSLLYDTVTRLNQKSNRVWML"
     MKNKLSTLFF ITIFLILIFI DSAKGDERKN FWKSRFTAGR GNITNKPTEV NHPIKKEGEN        60
     FLSVGKGDHD ESRVMLLKEL YQKDNELNIV RKKHKKYKSI TVALASIIGM MLLRNIGSLL       120
     YDTVTRLNQK SNRVWML                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page