(data stored in ACNUC9543 zone)

EMBL: AL844507.PE294

AL844507.PE294       Location/Qualifiers
FT   CDS             complement(join(1296134..1297984,1298152..1298328))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0830500"
FT                   /product="sporozoite and liver stage tryptophan-rich
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0830500"
FT                   /db_xref="GOA:Q8IBD1"
FT                   /db_xref="InterPro:IPR022089"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBD1"
FT                   /protein_id="CAD51075.1"
FT                   /translation="MNLEQFKNINKDLATNLFSQLSFLKNENKFLSQGKSLIKFLIGIA
FT                   IFLVVLIFIKSSHPALKEKKKKVLEFFENLVLNKKKKENITAAIASKELADAETTDTSD
FT                   SEDEDHIINKKVKRRKRNIINNPDEKVHNVKEKNSKSKNEEDKTDESYNETSLLSSDEE
FT                   GEVNLEDWKKNEWIKWMDETEEEWQLLKLWLEGEKNKWLEGKNKEYDIWLNHMNSKWTN
FT                   YNKDIDEEYDSNVFKDSYKWNEKQWEQWMKTEGKEFMLQDFKRWLEDSEGYLKSWLIKQ
FT                   WIQWKNMKILECLMNEWRREEDEKWSNLEDTDQIRVLNHKDRKEWLRWKERVTREKLEW
FT                   KHWVEMKENMNIYNKWKKWIKWKKNKLANFNEWSKNFIEKWIREKQWNNWINERKKYTS
FT                   QRKSLEQQFGDNMDKMNKLKKKKILKFFPLFNYKSDLESIMEEDENEYNSFDENEEEND
FT                   EKTGDVNVGKTEALNVAKTEGLNVGKTEDLNVAKTEDLNVAKTADLNAEKTTDLNSEKT
FT                   ADLNSDKTTDLNPEKTTNFNTYKATDLNANKTADLNSDKTTDLNSDKTTNFNTYRTTDL
FT                   NSDKTTNFNTYKTDLYAEKTTDVNLGKTTNHNVAKTTDQKVVKHSLDHEVRQMIDQKVA
FT                   QIMNHDLESTAEQKAEKKGGKAKAKTKVRTVDDDGNEINV"
     MNLEQFKNIN KDLATNLFSQ LSFLKNENKF LSQGKSLIKF LIGIAIFLVV LIFIKSSHPA        60
     LKEKKKKVLE FFENLVLNKK KKENITAAIA SKELADAETT DTSDSEDEDH IINKKVKRRK       120
     RNIINNPDEK VHNVKEKNSK SKNEEDKTDE SYNETSLLSS DEEGEVNLED WKKNEWIKWM       180
     DETEEEWQLL KLWLEGEKNK WLEGKNKEYD IWLNHMNSKW TNYNKDIDEE YDSNVFKDSY       240
     KWNEKQWEQW MKTEGKEFML QDFKRWLEDS EGYLKSWLIK QWIQWKNMKI LECLMNEWRR       300
     EEDEKWSNLE DTDQIRVLNH KDRKEWLRWK ERVTREKLEW KHWVEMKENM NIYNKWKKWI       360
     KWKKNKLANF NEWSKNFIEK WIREKQWNNW INERKKYTSQ RKSLEQQFGD NMDKMNKLKK       420
     KKILKFFPLF NYKSDLESIM EEDENEYNSF DENEEENDEK TGDVNVGKTE ALNVAKTEGL       480
     NVGKTEDLNV AKTEDLNVAK TADLNAEKTT DLNSEKTADL NSDKTTDLNP EKTTNFNTYK       540
     ATDLNANKTA DLNSDKTTDL NSDKTTNFNT YRTTDLNSDK TTNFNTYKTD LYAEKTTDVN       600
     LGKTTNHNVA KTTDQKVVKH SLDHEVRQMI DQKVAQIMNH DLESTAEQKA EKKGGKAKAK       660
     TKVRTVDDDG NEINV                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page