(data stored in ACNUC9543 zone)

EMBL: AL844507.PE295

AL844507.PE295       Location/Qualifiers
FT   CDS             join(1303323..1303472,1303593..1304813)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0830600"
FT                   /product="Plasmodium exported protein (PHISTc), unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0830600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.4:mRNA"
FT                   /db_xref="GOA:Q8IBD2"
FT                   /db_xref="InterPro:IPR019111"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBD2"
FT                   /protein_id="CAD51074.1"
FT                   /translation="MEYLKKTLFISEKNKLWMKKERQYKKYRSRNYIGYRCLIVSLLIF
FT                   YLIIQLSYDNFGENTYNSNDSIIRNRDSRILYEFLSNSYEYDHYNDYVNVEEFNDFSND
FT                   ILEDFSSISNNVNDYGYDNLDENVNLMSFIEVTEVLNDGQNTPPESNVDYVVSELNDDI
FT                   IDEEEDKRLKEAYERILRKRRGISGRHPYHILTSSCNEFNSNNIINEEELDHVELIQNE
FT                   MDSDSYNVLTEEDVQNINSSYNNEELNNNNNNNIRSTSENNVNTYELPNGELHNNSDRL
FT                   NGADVVNMNLYFNGDVYSSLENLEETVETRNEEDEDNEDDEEEFEKMLNELKNNGTLGE
FT                   TCRIWNKLCFIENKKFYNMQMKLWNFCEILAFEYKIPQSTLANEWKKIVTYTNEELIQH
FT                   NLTNISDFNTLVFNKIYDALDFIEFIKHKRESWKQFRESEEPVWKNTLEKNFKNYVQ"
     MEYLKKTLFI SEKNKLWMKK ERQYKKYRSR NYIGYRCLIV SLLIFYLIIQ LSYDNFGENT        60
     YNSNDSIIRN RDSRILYEFL SNSYEYDHYN DYVNVEEFND FSNDILEDFS SISNNVNDYG       120
     YDNLDENVNL MSFIEVTEVL NDGQNTPPES NVDYVVSELN DDIIDEEEDK RLKEAYERIL       180
     RKRRGISGRH PYHILTSSCN EFNSNNIINE EELDHVELIQ NEMDSDSYNV LTEEDVQNIN       240
     SSYNNEELNN NNNNNIRSTS ENNVNTYELP NGELHNNSDR LNGADVVNMN LYFNGDVYSS       300
     LENLEETVET RNEEDEDNED DEEEFEKMLN ELKNNGTLGE TCRIWNKLCF IENKKFYNMQ       360
     MKLWNFCEIL AFEYKIPQST LANEWKKIVT YTNEELIQHN LTNISDFNTL VFNKIYDALD       420
     FIEFIKHKRE SWKQFRESEE PVWKNTLEKN FKNYVQ                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page