(data stored in ACNUC9543 zone)

EMBL: AL844507.PE296

AL844507.PE296       Location/Qualifiers
FT   CDS             join(1307053..1307163,1307379..1307924)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0830700"
FT                   /product="Plasmodium exported protein (hyp9), unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0830700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.3:mRNA"
FT                   /db_xref="GOA:Q8IBD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBD3"
FT                   /protein_id="CAD51073.1"
FT                   /translation="MKSIINNRTFNKMNIFILFINILVIDLFCVSVEFFNKHCFYKTAN
FT                   ENVKLASSLSDRLSRSLALRSHNEVGQPVFNVLNVNLNTEIKKKDMITEVETEFEVLEV
FT                   CAEEEDGENEIRITMKTNLKPDMIKLRALNEEVTLKKWDFIMDDLAKCEYKKQKEKLNK
FT                   KTVVRKIAEGLGYTIVFTIGAPILLGASIVGACKWFLISKDSGKLFFKSLKEILF"
     MKSIINNRTF NKMNIFILFI NILVIDLFCV SVEFFNKHCF YKTANENVKL ASSLSDRLSR        60
     SLALRSHNEV GQPVFNVLNV NLNTEIKKKD MITEVETEFE VLEVCAEEED GENEIRITMK       120
     TNLKPDMIKL RALNEEVTLK KWDFIMDDLA KCEYKKQKEK LNKKTVVRKI AEGLGYTIVF       180
     TIGAPILLGA SIVGACKWFL ISKDSGKLFF KSLKEILF                               218
//

If you have problems or comments...

PBIL Back to PBIL home page