(data stored in SCRATCH zone)

EMBL: AL844507.PE297

AL844507.PE297       Location/Qualifiers
FT   CDS             join(1310637..1312343,1312513..1316955)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0830800"
FT                   /product="surface-associated interspersed protein 8.2
FT                   (SURFIN 8.2)"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0830800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0002:mRNA"
FT                   /db_xref="GOA:Q8IBD4"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBD4"
FT                   /protein_id="CAD51072.1"
FT                   /translation="MLMVIEFDDPIKEPSDKRISINRFREVFVNYVEDTLEELANNTTN
FT                   TYEKKCRDFNYFIDDVKDMFINHDLVKSTPEILKKVWESDIDKNLPGLMEKTTKNTCVR
FT                   VAHDYEKEYRDLRKNLEDFCDEKIERLAKLKISNNYMNDCFDYNKWINEKRNEFITGMT
FT                   GMDRRKKQMYLRKSDSCDLNNLANLFLNIICTRPRDVPGKPSSKDSGVKDKKKDDGSEE
FT                   EVVKDDNGDTSKGTSSDGDKDKSVEDTYDVDISEDGSPNEDISIVIEEPAQCEEGDHCF
FT                   DIIKFYESHKNGVPPIDINLSVRCPLNYHGIFRKGNKLYKSIENKSESNSMKRSSKRSI
FT                   GSENEQAISDNTDMEIIIDGDPYSAPCFIPEEEPCRPSVQETEGGKTGKGIFPHSESSN
FT                   NNVVPKTEVTLNFISPDRDRINPPERTYNLMNDGFMSTKNLLSVSGGNDIMYISHRSHA
FT                   APTNARLGRSTMTPKAEKSTLDDIKELIFSFPTNEAQKYESSSVTVPTSSTINQVNNDN
FT                   VSTHTGSNENGTVQKKDEIPETNRKENKIYSYFFNSILAIFIIFIIYQIFMKESTFLWF
FT                   SKNDKKRRIMKNIQEKVTKKMRKSDISEKFEKDIVDMKPTKSDIIRDRFIRNIYNVQYR
FT                   NEFDEEIKDYIQLKYLIYDDEERTKKKKYHEEYEKKDFQDDVIKTEKDKIFLSKEREWK
FT                   WKTIIEIHMEVLEDCKNEEWEKNKGDFLEICIEEFMKEDNEFNNNIKKNKDDLLINKNE
FT                   DIYFSNVIEKQIGLWNKWIERHRYMIEKWKKEDWFCDLKETLKNEFEEQMDIGKVSFLY
FT                   ENNREYGKNFYLEKQKIIWKRWIARYVKHIDDYIIEIWFKRMMDELEKAQGNLGKSSCE
FT                   KDEIINIESNHENLNFYKKKKKKLINKIWIQIHMMLLEEYKKEECKRSKNILLDNYIDI
FT                   LKRDGNEKKNMNILEILIEMKKKYISENEDYEKKVFKEDKVFEDYMGDWEYYEKNYINE
FT                   KENDTYKQDDIKIKKYFLENPFVEMEKDMTERYMNNIYDNYLSKGYEQETIIKSIHEIN
FT                   DTKKSIEEFHKEEKYDDTEKKKEKWKTVIEIYMEVFNESKKDEWEECRGDFLQICLEEF
FT                   LKTKDGINRDDNINEGDNINRDDNINEGDNINKGDNINKGDNINKGDNINKGDNINKDG
FT                   YINETDYLYSEENIKGYDHINTYPINGDIKNKYLLERQKIIWLKCIKRNKYILEKWKNE
FT                   EWFKKLKYNWNDEVNRKLHGNNLYDNVNTNNKRNPMIERQKIIWRKWIAKHVYNIDIME
FT                   NEEWFKEFIKKYEKEDYDYISGTYEIQEEIKKKKLLSKVFIDIYMMVLEDFKEEECKKN
FT                   KEIFLDTYIDELKKDSQSEKNKSMLNILDEIKSDIHIGYQKENMKEWKNKHWFEKLKKE
FT                   WNIRENKNYDEIEKNKMEKIHFTVINNYMLEIQNAIMKKYWDDMEIQWIDYDNKTDWLK
FT                   IAVQLSNNEKNVCNSRYDYIRNNNLYNKNKYMTIEEQDMKEVDTYDTYEKNLLFFERII
FT                   KMYMELLGEYKKADWDKNKGDFLKIALEEFVETKYEKQNDLRIIERINDNNNNEYDENY
FT                   ISIQQNLLWNKWIERKRYIIEKWKNEEWFEKLKSEWKKEQNKDIKQDQIQILIEKKENS
FT                   VTDNYDNINILTEIEKILWRNWLRNQKSVMGKYKDQKWFKDVLYKYEKELKELENLKSD
FT                   YLKNDISKIMDEELDMKNREYLIIQMWMEIHMMILEDCKKDEYINSEEIFLDACVEKLK
FT                   NEKNEKYQNRMLEIIMNIKEKHMLSKKEYMKNEWKKKEKLFEIFKKNCISEQDKYILEE
FT                   EIQKDIIKDIEKNKRYINNNDDIIKNGYIEKQKAICKKRVEKYLRHMDELSEENSFINF
FT                   MTKDQIRNSNNNELEKLIKEEILKKILSTEMDMTFLDEFNKGEFMENSEDSINVDIKRK
FT                   RKKKEKHIMENDDENIYKMENDDENIYKMEKEDNFININELELHKEFDNNNKVKLKELH
FT                   TEFHKDEQEILSSQYENIENAMINDNENYDNSNYMKNIIEQKMIILKEYYNRKKYTL"
     MLMVIEFDDP IKEPSDKRIS INRFREVFVN YVEDTLEELA NNTTNTYEKK CRDFNYFIDD        60
     VKDMFINHDL VKSTPEILKK VWESDIDKNL PGLMEKTTKN TCVRVAHDYE KEYRDLRKNL       120
     EDFCDEKIER LAKLKISNNY MNDCFDYNKW INEKRNEFIT GMTGMDRRKK QMYLRKSDSC       180
     DLNNLANLFL NIICTRPRDV PGKPSSKDSG VKDKKKDDGS EEEVVKDDNG DTSKGTSSDG       240
     DKDKSVEDTY DVDISEDGSP NEDISIVIEE PAQCEEGDHC FDIIKFYESH KNGVPPIDIN       300
     LSVRCPLNYH GIFRKGNKLY KSIENKSESN SMKRSSKRSI GSENEQAISD NTDMEIIIDG       360
     DPYSAPCFIP EEEPCRPSVQ ETEGGKTGKG IFPHSESSNN NVVPKTEVTL NFISPDRDRI       420
     NPPERTYNLM NDGFMSTKNL LSVSGGNDIM YISHRSHAAP TNARLGRSTM TPKAEKSTLD       480
     DIKELIFSFP TNEAQKYESS SVTVPTSSTI NQVNNDNVST HTGSNENGTV QKKDEIPETN       540
     RKENKIYSYF FNSILAIFII FIIYQIFMKE STFLWFSKND KKRRIMKNIQ EKVTKKMRKS       600
     DISEKFEKDI VDMKPTKSDI IRDRFIRNIY NVQYRNEFDE EIKDYIQLKY LIYDDEERTK       660
     KKKYHEEYEK KDFQDDVIKT EKDKIFLSKE REWKWKTIIE IHMEVLEDCK NEEWEKNKGD       720
     FLEICIEEFM KEDNEFNNNI KKNKDDLLIN KNEDIYFSNV IEKQIGLWNK WIERHRYMIE       780
     KWKKEDWFCD LKETLKNEFE EQMDIGKVSF LYENNREYGK NFYLEKQKII WKRWIARYVK       840
     HIDDYIIEIW FKRMMDELEK AQGNLGKSSC EKDEIINIES NHENLNFYKK KKKKLINKIW       900
     IQIHMMLLEE YKKEECKRSK NILLDNYIDI LKRDGNEKKN MNILEILIEM KKKYISENED       960
     YEKKVFKEDK VFEDYMGDWE YYEKNYINEK ENDTYKQDDI KIKKYFLENP FVEMEKDMTE      1020
     RYMNNIYDNY LSKGYEQETI IKSIHEINDT KKSIEEFHKE EKYDDTEKKK EKWKTVIEIY      1080
     MEVFNESKKD EWEECRGDFL QICLEEFLKT KDGINRDDNI NEGDNINRDD NINEGDNINK      1140
     GDNINKGDNI NKGDNINKGD NINKDGYINE TDYLYSEENI KGYDHINTYP INGDIKNKYL      1200
     LERQKIIWLK CIKRNKYILE KWKNEEWFKK LKYNWNDEVN RKLHGNNLYD NVNTNNKRNP      1260
     MIERQKIIWR KWIAKHVYNI DIMENEEWFK EFIKKYEKED YDYISGTYEI QEEIKKKKLL      1320
     SKVFIDIYMM VLEDFKEEEC KKNKEIFLDT YIDELKKDSQ SEKNKSMLNI LDEIKSDIHI      1380
     GYQKENMKEW KNKHWFEKLK KEWNIRENKN YDEIEKNKME KIHFTVINNY MLEIQNAIMK      1440
     KYWDDMEIQW IDYDNKTDWL KIAVQLSNNE KNVCNSRYDY IRNNNLYNKN KYMTIEEQDM      1500
     KEVDTYDTYE KNLLFFERII KMYMELLGEY KKADWDKNKG DFLKIALEEF VETKYEKQND      1560
     LRIIERINDN NNNEYDENYI SIQQNLLWNK WIERKRYIIE KWKNEEWFEK LKSEWKKEQN      1620
     KDIKQDQIQI LIEKKENSVT DNYDNINILT EIEKILWRNW LRNQKSVMGK YKDQKWFKDV      1680
     LYKYEKELKE LENLKSDYLK NDISKIMDEE LDMKNREYLI IQMWMEIHMM ILEDCKKDEY      1740
     INSEEIFLDA CVEKLKNEKN EKYQNRMLEI IMNIKEKHML SKKEYMKNEW KKKEKLFEIF      1800
     KKNCISEQDK YILEEEIQKD IIKDIEKNKR YINNNDDIIK NGYIEKQKAI CKKRVEKYLR      1860
     HMDELSEENS FINFMTKDQI RNSNNNELEK LIKEEILKKI LSTEMDMTFL DEFNKGEFME      1920
     NSEDSINVDI KRKRKKKEKH IMENDDENIY KMENDDENIY KMEKEDNFIN INELELHKEF      1980
     DNNNKVKLKE LHTEFHKDEQ EILSSQYENI ENAMINDNEN YDNSNYMKNI IEQKMIILKE      2040
     YYNRKKYTL                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page