(data stored in ACNUC9543 zone)

EMBL: AL844507.PE298

AL844507.PE298       Location/Qualifiers
FT   CDS             complement(join(1317600..1318109,1318273..1318341))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0830900"
FT                   /product="Plasmodium exported protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0830900"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0001:mRNA"
FT                   /db_xref="GOA:Q8IBD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IBD5"
FT                   /protein_id="CAD51071.1"
FT                   /translation="MLSFNVIYITCVVVIFSLQYNNKVNLHNKVHNIYKTRYSLIIYFK
FT                   RLLIEYNETVQLEKNPDENSSTELDDNESTVSVEECEKSLKEFFDDCKRENYPGNVIHL
FT                   CDNVEEPEEIKKGGSKTNLLLEEYGDPVVYDKEEMKLISELLDSYLEDERHLCMIKRIL
FT                   DYTKIYRNPLLLARYRIKKFLKRRCKKIK"
     MLSFNVIYIT CVVVIFSLQY NNKVNLHNKV HNIYKTRYSL IIYFKRLLIE YNETVQLEKN        60
     PDENSSTELD DNESTVSVEE CEKSLKEFFD DCKRENYPGN VIHLCDNVEE PEEIKKGGSK       120
     TNLLLEEYGD PVVYDKEEMK LISELLDSYL EDERHLCMIK RILDYTKIYR NPLLLARYRI       180
     KKFLKRRCKK IK                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page