(data stored in ACNUC9543 zone)

EMBL: AL844507.PE3

AL844507.PE3         Location/Qualifiers
FT   CDS             join(40948..48582,49632..50939)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0800300"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0800300"
FT                   /db_xref="GOA:Q8IAK3"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAK3"
FT                   /protein_id="CAD51361.1"
FT                   /translation="MVPPVRSPRAAGPAPAPASASTTYGSVKDLLEDIGKSIQKQAKDA
FT                   AEKRSNGELQGDLSKARFKDQKNTTTNPCQLNYRNHSNVRSSFENDNPCYGREEKRFSD
FT                   SRSGQCTYNRIKDSKEGDNKVGACAPYRRLHICDHNLENINDYKNINNHTLLVDVCLSA
FT                   KHEGEMIANKLKEYDKSNYESRICTVLARSFADIGDIVRGKDLYLGDQQEKLYLENNLK
FT                   KIFAKIHENLNDKIKSNYNDSEGNYFKLREDWWTANRDQVWKAITCNAPKDANYFEYNS
FT                   GKFFKFSNDQCGHNNGGAPPTNLDYVPQFVRWFEEWADDFCRIRKHKLKNIKDVCRNES
FT                   KPLYCSLNGYDCTKTSWKNDFESREHYCTPCFSACSLYKIWVANQKKEFEKQKKKYEKE
FT                   IPKYVSKKVKTNSTINNYYYYDFYEKLQKNEYGNIDAFLNLLKEGKYCKENLPEEEVIN
FT                   FTKHDEKKTFSLSNYCVVCPDCGVEYKNGRYTAKDQKYPDCRNEKYDPNNAETTDITVL
FT                   YSGDVGDFSEKLQDFCNDINNGKVKNYQIWQCYYENSEINKCQMTPSSHKVPKHGYIMS
FT                   FFAFFDLWVKNLLIDTINWKNELTNCINNTNVTDCKNDCNTNCKCFENWAKTKEKEWEN
FT                   VKTIYKNENRNTNNYYKKLNDLFKGYFFHVMYELNNEEAKWNKLMKNLRTKIDSSRKNA
FT                   GNEDSEGAIKVLFDHLKDIAERCIDNNSIKPCNSHPKPTPNPCGKNNNGGKLVRVKRPA
FT                   ELKQQKAHIQLEKRGGESNLKGDATRGTYNLGCQGDQLDATFCNIDEKYSNRIPRKSEG
FT                   PCYGKNPQRFYTGKDWTHVVQEKTSYKDVFLPPRREHMCTSNLENLNLNSKGLSNSSIA
FT                   SNSLLGDVLLAAKYEADDIVKKNDSDKSSICNAMKYSFADIGDIIRGKDMWDLDSGSKD
FT                   MEKHLISIFEKIKENLDVIKYNSKYKDTQKFLDLRSDWWEANRHQVWRAMKCAIENDKD
FT                   MKCNGIPIEDYIPQRLRWMTEWAEWYCKAQKKEYDELVKGCKGCMGNGQGCTKDSSDGE
FT                   CKKCTEACNTYKQKIKTWENQWKKIKGKYEKLYEQATKNGETSGTPNEKDKDVVDFLKQ
FT                   LLPRNSAAARNRVIRAAGSSAPGVTALTPITLYSSAAGYIHQELGKTVGCNTQKEFCKN
FT                   GSGEKYAFKHPPKEYKDACSCNTRDKKSEAPVTKKEEACKIVDGILKGNDGINEISGCN
FT                   PKESYPEWQCDKSKFKNGEEGACMPPRRQKLCVSGLTQGGKITTIEDIRTQFITCAAIE
FT                   THFAWHKYKKDNVNAERELNSGIIPHEFKRQMYYTFGDYRDIFFGTDISTHNHIPEVSQ
FT                   KVITILEKENLTKSEVKQKYKNELLDDWWNEHGKEIWDGMVCALCYDTKTKEFKNEVRT
FT                   QLTGPNSKYQYGTVSFGDKQNTILSKFAERPPFLRWFIEWGEEFCKKRKEQVDQLVNVC
FT                   KECNVSDSVISSGNKTCNDKEKCDACKKECTQYENWLQTWKGHYNKQKERYAKVKSTSP
FT                   YNNDNDVNKSTHAYEYLSKKLTNIPCTNGNTTGKCDYKCMDQRTSTDGMPASLEYPPKE
FT                   INGKCDCTKALPPQEPPSTPESRGRSLNPPPDSPQPPRGPEEQEESASYSEEEEEEEEE
FT                   EEENDEENDGDEEEVKTEDGGSDDEDEDEEDDEEEEENEVDVDEPQQEEVEEPPAKESA
FT                   PTTQEPAVPEVKKQEVKVCDIVSKILTKDALQDACKLKYNGKYYGWKCISGATTGGLCI
FT                   PPRRRKLYVTPLTKWATTAVSSEATPAPSQSESDKLREAFIQSAAIETFFLWHKYKQEK
FT                   KPPSEQNAGAALVLLQGVTPQEDPQNKLKSGTIPEEFKRQMFYTLGDYADIFFGKNDIL
FT                   IGKTGTGSAKDEMADKESKIKEAIKKFFQNGDSQPLSGKPVTQSSDKRTALWGDFAQDI
FT                   WHGMICALTYTDSGEKGELPKEDDKVKDKLWDDTKKQPKKEEYQYDKVKLDENSGDGPK
FT                   TSQPPSAPSDTPTTLDSFIKRPPYFRYLEEWGQNFCKKRTEMLGKIKGDCRVEDGSKNC
FT                   SGYGEDCDDQLGEDPSTVPSLKCQSCGEECRKYKKWIERKKDEFTKHSNAYGDQKAKCQ
FT                   AKSGGGGNGFCGTLERCSKAAEFLKTLGSCKTNNGNESVEANKTIFDNIGETFKPATNC
FT                   KPCSQFKIYCKNCKSSGDDTNVGCNCKENGNGYITSDHIKNEDNFTDPVDMLVSDDNTN
FT                   GNKFADLQACGGAGIFKGIRKDQWKCRNVCGYVVCKSEKGNGETVRGEKNDVKHIITIR
FT                   ALVTHWVEYFLDDYNKINKKLNRCMKDGEGYQCIKDCVEKWIQNKREEWKKIKELYLQE
FT                   YKNNNQPDYLVKIILEELHPQTQLNEAIKPCKTFDDFKSFCGLNGAESSKKSKNSNDND
FT                   LVLCMLNKLEKKIDECKQKHQASGKNTAQCQEYPPLPDEEYENEEENDKKVEPPTFCEI
FT                   KDTPEPADEDACKAAPKETAPSSEENQPETPVIKPEEEAPAPEEPPPAPPPLAPSDESI
FT                   LHTTIPFGVALALGSIAFLFLKKKTKSTIDLLRVINIPKSDYNIPTKLSPNRYIPYTSG
FT                   KYRGKRYIYIEGDSGTDSGYTDHYSDITSSSESEYEELDINDIYVPGTPKYKTLIEVVL
FT                   EPSGNNTTASGKNTPSDTQNDIQNDGIPSSKITDNEWNTLKDEFISQYLQSEQPKDVPN
FT                   DYKSGDIPFNTQPNTLYFDKPEEKPFITSIHDRNLYSGEEHSYNVNMVNSMDDIPINSH
FT                   NNVYSGIDLINDTLSGNQHIDIYDELLKRKENELFGTNHVKQTSIHSVAKPISDDPIHN
FT                   QLELFHKWLDRHRDMCEKWENHHERLAKLKEEWENDTSTSGNTHPSDSNKTLNTDVSIQ
FT                   IDMDNPKTTNEFTYVDSNPNQVDDTYVDSNPDNSSMDTILEDLEKYKEPYYDVQDDIYY
FT                   DVHDHDTSTVDTNAMDVPSKVQIEMDINTKLVKEKYPIGDVWDI"
     MVPPVRSPRA AGPAPAPASA STTYGSVKDL LEDIGKSIQK QAKDAAEKRS NGELQGDLSK        60
     ARFKDQKNTT TNPCQLNYRN HSNVRSSFEN DNPCYGREEK RFSDSRSGQC TYNRIKDSKE       120
     GDNKVGACAP YRRLHICDHN LENINDYKNI NNHTLLVDVC LSAKHEGEMI ANKLKEYDKS       180
     NYESRICTVL ARSFADIGDI VRGKDLYLGD QQEKLYLENN LKKIFAKIHE NLNDKIKSNY       240
     NDSEGNYFKL REDWWTANRD QVWKAITCNA PKDANYFEYN SGKFFKFSND QCGHNNGGAP       300
     PTNLDYVPQF VRWFEEWADD FCRIRKHKLK NIKDVCRNES KPLYCSLNGY DCTKTSWKND       360
     FESREHYCTP CFSACSLYKI WVANQKKEFE KQKKKYEKEI PKYVSKKVKT NSTINNYYYY       420
     DFYEKLQKNE YGNIDAFLNL LKEGKYCKEN LPEEEVINFT KHDEKKTFSL SNYCVVCPDC       480
     GVEYKNGRYT AKDQKYPDCR NEKYDPNNAE TTDITVLYSG DVGDFSEKLQ DFCNDINNGK       540
     VKNYQIWQCY YENSEINKCQ MTPSSHKVPK HGYIMSFFAF FDLWVKNLLI DTINWKNELT       600
     NCINNTNVTD CKNDCNTNCK CFENWAKTKE KEWENVKTIY KNENRNTNNY YKKLNDLFKG       660
     YFFHVMYELN NEEAKWNKLM KNLRTKIDSS RKNAGNEDSE GAIKVLFDHL KDIAERCIDN       720
     NSIKPCNSHP KPTPNPCGKN NNGGKLVRVK RPAELKQQKA HIQLEKRGGE SNLKGDATRG       780
     TYNLGCQGDQ LDATFCNIDE KYSNRIPRKS EGPCYGKNPQ RFYTGKDWTH VVQEKTSYKD       840
     VFLPPRREHM CTSNLENLNL NSKGLSNSSI ASNSLLGDVL LAAKYEADDI VKKNDSDKSS       900
     ICNAMKYSFA DIGDIIRGKD MWDLDSGSKD MEKHLISIFE KIKENLDVIK YNSKYKDTQK       960
     FLDLRSDWWE ANRHQVWRAM KCAIENDKDM KCNGIPIEDY IPQRLRWMTE WAEWYCKAQK      1020
     KEYDELVKGC KGCMGNGQGC TKDSSDGECK KCTEACNTYK QKIKTWENQW KKIKGKYEKL      1080
     YEQATKNGET SGTPNEKDKD VVDFLKQLLP RNSAAARNRV IRAAGSSAPG VTALTPITLY      1140
     SSAAGYIHQE LGKTVGCNTQ KEFCKNGSGE KYAFKHPPKE YKDACSCNTR DKKSEAPVTK      1200
     KEEACKIVDG ILKGNDGINE ISGCNPKESY PEWQCDKSKF KNGEEGACMP PRRQKLCVSG      1260
     LTQGGKITTI EDIRTQFITC AAIETHFAWH KYKKDNVNAE RELNSGIIPH EFKRQMYYTF      1320
     GDYRDIFFGT DISTHNHIPE VSQKVITILE KENLTKSEVK QKYKNELLDD WWNEHGKEIW      1380
     DGMVCALCYD TKTKEFKNEV RTQLTGPNSK YQYGTVSFGD KQNTILSKFA ERPPFLRWFI      1440
     EWGEEFCKKR KEQVDQLVNV CKECNVSDSV ISSGNKTCND KEKCDACKKE CTQYENWLQT      1500
     WKGHYNKQKE RYAKVKSTSP YNNDNDVNKS THAYEYLSKK LTNIPCTNGN TTGKCDYKCM      1560
     DQRTSTDGMP ASLEYPPKEI NGKCDCTKAL PPQEPPSTPE SRGRSLNPPP DSPQPPRGPE      1620
     EQEESASYSE EEEEEEEEEE ENDEENDGDE EEVKTEDGGS DDEDEDEEDD EEEEENEVDV      1680
     DEPQQEEVEE PPAKESAPTT QEPAVPEVKK QEVKVCDIVS KILTKDALQD ACKLKYNGKY      1740
     YGWKCISGAT TGGLCIPPRR RKLYVTPLTK WATTAVSSEA TPAPSQSESD KLREAFIQSA      1800
     AIETFFLWHK YKQEKKPPSE QNAGAALVLL QGVTPQEDPQ NKLKSGTIPE EFKRQMFYTL      1860
     GDYADIFFGK NDILIGKTGT GSAKDEMADK ESKIKEAIKK FFQNGDSQPL SGKPVTQSSD      1920
     KRTALWGDFA QDIWHGMICA LTYTDSGEKG ELPKEDDKVK DKLWDDTKKQ PKKEEYQYDK      1980
     VKLDENSGDG PKTSQPPSAP SDTPTTLDSF IKRPPYFRYL EEWGQNFCKK RTEMLGKIKG      2040
     DCRVEDGSKN CSGYGEDCDD QLGEDPSTVP SLKCQSCGEE CRKYKKWIER KKDEFTKHSN      2100
     AYGDQKAKCQ AKSGGGGNGF CGTLERCSKA AEFLKTLGSC KTNNGNESVE ANKTIFDNIG      2160
     ETFKPATNCK PCSQFKIYCK NCKSSGDDTN VGCNCKENGN GYITSDHIKN EDNFTDPVDM      2220
     LVSDDNTNGN KFADLQACGG AGIFKGIRKD QWKCRNVCGY VVCKSEKGNG ETVRGEKNDV      2280
     KHIITIRALV THWVEYFLDD YNKINKKLNR CMKDGEGYQC IKDCVEKWIQ NKREEWKKIK      2340
     ELYLQEYKNN NQPDYLVKII LEELHPQTQL NEAIKPCKTF DDFKSFCGLN GAESSKKSKN      2400
     SNDNDLVLCM LNKLEKKIDE CKQKHQASGK NTAQCQEYPP LPDEEYENEE ENDKKVEPPT      2460
     FCEIKDTPEP ADEDACKAAP KETAPSSEEN QPETPVIKPE EEAPAPEEPP PAPPPLAPSD      2520
     ESILHTTIPF GVALALGSIA FLFLKKKTKS TIDLLRVINI PKSDYNIPTK LSPNRYIPYT      2580
     SGKYRGKRYI YIEGDSGTDS GYTDHYSDIT SSSESEYEEL DINDIYVPGT PKYKTLIEVV      2640
     LEPSGNNTTA SGKNTPSDTQ NDIQNDGIPS SKITDNEWNT LKDEFISQYL QSEQPKDVPN      2700
     DYKSGDIPFN TQPNTLYFDK PEEKPFITSI HDRNLYSGEE HSYNVNMVNS MDDIPINSHN      2760
     NVYSGIDLIN DTLSGNQHID IYDELLKRKE NELFGTNHVK QTSIHSVAKP ISDDPIHNQL      2820
     ELFHKWLDRH RDMCEKWENH HERLAKLKEE WENDTSTSGN THPSDSNKTL NTDVSIQIDM      2880
     DNPKTTNEFT YVDSNPNQVD DTYVDSNPDN SSMDTILEDL EKYKEPYYDV QDDIYYDVHD      2940
     HDTSTVDTNA MDVPSKVQIE MDINTKLVKE KYPIGDVWDI                            2980
//

If you have problems or comments...

PBIL Back to PBIL home page