(data stored in ACNUC9543 zone)

EMBL: AL844507.PE30

AL844507.PE30        Location/Qualifiers
FT   CDS             complement(199181..202918)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0803100"
FT                   /product="U3 small nucleolar RNA-associated protein 14,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0803100"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0127:mRNA"
FT                   /db_xref="GOA:Q8IAN1"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAN1"
FT                   /protein_id="CAD51332.1"
FT                   /translation="MNYDEDIKRRKKKKTEKLKNTKESLSLYESNNKNILSIKNKKLLK
FT                   DKKNKMKIQKMKNKYDKDDGTIKHKKGNKIISSDDKFDEDITNLYMKKSKKCMKDTMVK
FT                   KKKKKMKNQNYEKDKNYIGVVMDEDEIIIDNEERIIENVNNVENDHVPYTNDSDKSDEE
FT                   YSSVNFMKFLKNCNDNEREVNKKKKKKKKSTDGNHKNDDHNDDNDDDNDDDDNDDDNND
FT                   DDNNDDNDDDNNDDDNNDDDNNDDNDDDNIKKKLVHSGDQDDHHVDDDSSSVQDSYQYY
FT                   ALKDDMYKLSNENKEKIEFADLMYSNNNFFGQGLQKDLDFLENEQNKKKGKKRLSFIEE
FT                   QKFNTTLGYVQNVKLLNKMNKAYNVIQNSSKVEFGRQKEKRGNQGEDFVNKRLVKRFLK
FT                   RKEKIQPEMYDGHEESGYIDDNDDNIINNNILKRHKVDQTHLNGYGEQNEVYNKKEKKI
FT                   IKREHKKEEDFTIYNFEEEIKMNLLKSKMLHISEDLLKNEKEKKRDELKKIAQLKLLLS
FT                   IENRKNYYKKKIKSKSYRKYLRIKEKKEEEKIMKKLYSEHPDLVKDLMNYEKEYAEKRN
FT                   LLNNIKKRKTIKTLNRYKNEQLKKEILKSIQSNKEEKNMLKKIIEKTALTEQTNEDNNM
FT                   MIHDDNDDDDDDNMSEDTDEISSKDHDNMNYSDKCSNDNIKNDDDLYDKKRKKKIYDEF
FT                   EKRNLLRFSFVKNAEENKRNDEIYNRRKDILKKLENRNKKNMDNTYEDNNNNNKYNVDE
FT                   DNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVD
FT                   EDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNSLDSFSSDEIIKNDE
FT                   ESHILFSNNKLSDYSHKELSKAKKELKNDIDFVNSLKKTDILHIDDVEDITDVISGYDE
FT                   EDNEKNGNVNNDNVNNDNVNNDNVNNDNVNNDNINNDNINNDNVNNDNVNNDKEMKLLD
FT                   DITSADTNVSPNEHLKGDVKDKEDIEVGSKTKKKKSQSNNTTSSSSSNNWNNNLDGEGD
FT                   KEKKNKTKVIENNLKTINEVNNEHILESYCKNINVYNFENNTYEDYINPKNDDIKEDEE
FT                   LYELSEDEKIKDIEVNKKEWCNYNTLLELEKNKMIKEKEIIETKKNKPLHTITLHNKKD
FT                   KKFDKYYVDKIPYPYDKNGYEKTLNININKEINDLSAYKQLIAPQYSNKVGNVISPLIK
FT                   NPFDLANIFTLKRKNQKSKL"
     MNYDEDIKRR KKKKTEKLKN TKESLSLYES NNKNILSIKN KKLLKDKKNK MKIQKMKNKY        60
     DKDDGTIKHK KGNKIISSDD KFDEDITNLY MKKSKKCMKD TMVKKKKKKM KNQNYEKDKN       120
     YIGVVMDEDE IIIDNEERII ENVNNVENDH VPYTNDSDKS DEEYSSVNFM KFLKNCNDNE       180
     REVNKKKKKK KKSTDGNHKN DDHNDDNDDD NDDDDNDDDN NDDDNNDDND DDNNDDDNND       240
     DDNNDDNDDD NIKKKLVHSG DQDDHHVDDD SSSVQDSYQY YALKDDMYKL SNENKEKIEF       300
     ADLMYSNNNF FGQGLQKDLD FLENEQNKKK GKKRLSFIEE QKFNTTLGYV QNVKLLNKMN       360
     KAYNVIQNSS KVEFGRQKEK RGNQGEDFVN KRLVKRFLKR KEKIQPEMYD GHEESGYIDD       420
     NDDNIINNNI LKRHKVDQTH LNGYGEQNEV YNKKEKKIIK REHKKEEDFT IYNFEEEIKM       480
     NLLKSKMLHI SEDLLKNEKE KKRDELKKIA QLKLLLSIEN RKNYYKKKIK SKSYRKYLRI       540
     KEKKEEEKIM KKLYSEHPDL VKDLMNYEKE YAEKRNLLNN IKKRKTIKTL NRYKNEQLKK       600
     EILKSIQSNK EEKNMLKKII EKTALTEQTN EDNNMMIHDD NDDDDDDNMS EDTDEISSKD       660
     HDNMNYSDKC SNDNIKNDDD LYDKKRKKKI YDEFEKRNLL RFSFVKNAEE NKRNDEIYNR       720
     RKDILKKLEN RNKKNMDNTY EDNNNNNKYN VDEDNNNKYN VDEDNNNKYN VDEDNNNKYN       780
     VDEDNNNKYN VDEDNNNKYN VDEDNNNKYN VDEDNNNKYN VDEDNNNKYN VDEDNNNKYN       840
     VDEDNNNKYN VDEDNNSLDS FSSDEIIKND EESHILFSNN KLSDYSHKEL SKAKKELKND       900
     IDFVNSLKKT DILHIDDVED ITDVISGYDE EDNEKNGNVN NDNVNNDNVN NDNVNNDNVN       960
     NDNINNDNIN NDNVNNDNVN NDKEMKLLDD ITSADTNVSP NEHLKGDVKD KEDIEVGSKT      1020
     KKKKSQSNNT TSSSSSNNWN NNLDGEGDKE KKNKTKVIEN NLKTINEVNN EHILESYCKN      1080
     INVYNFENNT YEDYINPKND DIKEDEELYE LSEDEKIKDI EVNKKEWCNY NTLLELEKNK      1140
     MIKEKEIIET KKNKPLHTIT LHNKKDKKFD KYYVDKIPYP YDKNGYEKTL NININKEIND      1200
     LSAYKQLIAP QYSNKVGNVI SPLIKNPFDL ANIFTLKRKN QKSKL                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page