(data stored in SCRATCH zone)

EMBL: AL844507.PE300

AL844507.PE300       Location/Qualifiers
FT   CDS             join(1325144..1326008,1326176..1326402,1326514..1331187)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831100"
FT                   /product="surface-associated interspersed protein 8.1
FT                   (SURFIN 8.1)"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.1:mRNA"
FT                   /db_xref="GOA:C0H4Z4"
FT                   /db_xref="InterPro:IPR024288"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Z4"
FT                   /protein_id="CAX64169.1"
FT                   /translation="MAIISSIPNYRKGLNPSLYNLRFSLFRDRVNAYTISKIKKLKKSR
FT                   NYKRLCRYLNYKLDDIKDVFMLNNVLGIPRTARMGLWENVMENKLKDIIEENSDNKCRR
FT                   IYPYFQRIQRRRRKALENFCEDKEKKQEELKNVKFDMKKCLEFNEWVKESENKIFKLFK
FT                   NNITERDKRKKAYIISDKCKLGNLNTLFGQMDCSDKIDRHFPYIFLEGNPVYPSEKDDD
FT                   KNIKDPEEGKDEEEEEEDGEVTINIRSNGEKGFRFVNNTLVLEGIEGSGFDLDFETYDI
FT                   SPHSLNSGEIANLFEFNNESHLEHMNIESNRSPNMVDIDFSDVPLTAAHMTSSITAKNI
FT                   SSYLYVPLGVLFIIISFIWFFLNRTKHLNMLIKEKEKVKTENIVPSEAYVKLDDLEVMS
FT                   EEIKEKQKEKLKKKIHAQKKLEIIEDPYKIKLLERKKWLWKTIIEIHMLILEEQRKAEW
FT                   EFNKGDFLNICIDEFSNQEKKPDTNIITSDLPFDEPEVIETIRMMNKQSDIWYRWVERH
FT                   AHMLEKWKEEEWFLRLKESWKDEEEEYMKRAYKELLISLRGDKYHMSQRQKIIWRKWIA
FT                   KHPYRIREFVIDKWFNQLFEELEKEGIISDEAIRNFLSQYEEAYDEEKIQEFIKYKKKV
FT                   LVVILWIKIYMSMLEEYVKEEDIESEKLFIDTSLEELKKKKEIEEEVLEDLKKDIYESD
FT                   EMKEIEKYKGEDWFKQMQQDWIRRDYKFVSSYNLESDDEEQFHEFVKKPTVEIQKDLLK
FT                   EQWKNIELKWIEEDNYDEYVLEDELLKETKYIKPKDKMKHRIIKEDNIYGEQLKVFDEI
FT                   EKRSIYLSSKRVLKWKTIIEIHLEVLHDCKKEEWDKNKRDFLNICIEELVKGQNEDKKN
FT                   KENYNYITNESDNYDIVEYTKSFCNTWKDRHNYMLEKWNKENWFVQLKNDWVEEQNEYM
FT                   RKTYKELLISLKGDKYNMSQRQKIIWRKWIAKHPYKINEEIINIWLNRLSDERDKNGII
FT                   SDEAIKKFLSLEKDISDKDFLKYRRKKLEVILWVKIYMSVLEEEKNEELEKSKESFLNT
FT                   CIDELKKEEYSEENERMITIVDEMKKGFRICDKVEDYKKKKWKNEEWYKDLKKEWIKEE
FT                   DKYIDSIYLMKKDEIYEDDLLNKSIVELEKSVSLKHWKDMYIKWIDEDNERDWLRIAID
FT                   KKNLKTDEINEDINRMIELNMLEDYSNDLYDKKKIKWKTIIEIHMEVLNDCKNDEWEMN
FT                   KGDFLDICLEEFGTMENKEYSHIINNMLMVGELEYKHLNMDVIERQNDLWNKWIEGHRY
FT                   MLEKWKKEKWFIVLKENWKNEEHKYMRKAYLELLMSLREDVKNPLLQRQKIIWRKWIAK
FT                   NLYHIESNVIKKWFDTLLEEIERKGVIELDGCINLIEMEENEEYLEYLKEYRKKKLICI
FT                   IWIKIYMMIIEEHKKEEYLECKEIFLDTCVDELREQEILEGNELYMDDMKTSILLNDQK
FT                   EEIEKLKMKKWYKDLKKEWIIEENRYFRSIINEEDDEEYKNMISKPLRDVEKKISKKHW
FT                   EDIQLKWIDEDNERDWLKIARNENEEIKYLYINENVSKKKKKVPFYIDDYRKKGRSNKN
FT                   KIYRRKREKCNVKLNENNTMNKEMENWENRMEFLKICVDLLKKRTFYYINIWEKNKAFY
FT                   DETNEIMKQLEEKIFERQKILWYNKEDMNKMSSKKWGNEEWFIILKNDWNEEKTCYLNG
FT                   IQYEYNINNLIEEEKKYLYLKKEKIIWKEWLLKNFKNIEECDNEDWFNNLMETYKIDEI
FT                   CTINMNGEIHSLGLENTLKRNFLKNIIWIDIFMGVLNACEEEEELEEHKHKNMLESKVE
FT                   DNDKLFYEKNEDYINKNEMENYINDIQENEGNQMDIPDWFDAYQSDEMSGKQKSIQKDE
FT                   QWFIKELEEGGIKSDVLQENYTIYNNKLIEQKMNILRESYIRNQNDT"
     MAIISSIPNY RKGLNPSLYN LRFSLFRDRV NAYTISKIKK LKKSRNYKRL CRYLNYKLDD        60
     IKDVFMLNNV LGIPRTARMG LWENVMENKL KDIIEENSDN KCRRIYPYFQ RIQRRRRKAL       120
     ENFCEDKEKK QEELKNVKFD MKKCLEFNEW VKESENKIFK LFKNNITERD KRKKAYIISD       180
     KCKLGNLNTL FGQMDCSDKI DRHFPYIFLE GNPVYPSEKD DDKNIKDPEE GKDEEEEEED       240
     GEVTINIRSN GEKGFRFVNN TLVLEGIEGS GFDLDFETYD ISPHSLNSGE IANLFEFNNE       300
     SHLEHMNIES NRSPNMVDID FSDVPLTAAH MTSSITAKNI SSYLYVPLGV LFIIISFIWF       360
     FLNRTKHLNM LIKEKEKVKT ENIVPSEAYV KLDDLEVMSE EIKEKQKEKL KKKIHAQKKL       420
     EIIEDPYKIK LLERKKWLWK TIIEIHMLIL EEQRKAEWEF NKGDFLNICI DEFSNQEKKP       480
     DTNIITSDLP FDEPEVIETI RMMNKQSDIW YRWVERHAHM LEKWKEEEWF LRLKESWKDE       540
     EEEYMKRAYK ELLISLRGDK YHMSQRQKII WRKWIAKHPY RIREFVIDKW FNQLFEELEK       600
     EGIISDEAIR NFLSQYEEAY DEEKIQEFIK YKKKVLVVIL WIKIYMSMLE EYVKEEDIES       660
     EKLFIDTSLE ELKKKKEIEE EVLEDLKKDI YESDEMKEIE KYKGEDWFKQ MQQDWIRRDY       720
     KFVSSYNLES DDEEQFHEFV KKPTVEIQKD LLKEQWKNIE LKWIEEDNYD EYVLEDELLK       780
     ETKYIKPKDK MKHRIIKEDN IYGEQLKVFD EIEKRSIYLS SKRVLKWKTI IEIHLEVLHD       840
     CKKEEWDKNK RDFLNICIEE LVKGQNEDKK NKENYNYITN ESDNYDIVEY TKSFCNTWKD       900
     RHNYMLEKWN KENWFVQLKN DWVEEQNEYM RKTYKELLIS LKGDKYNMSQ RQKIIWRKWI       960
     AKHPYKINEE IINIWLNRLS DERDKNGIIS DEAIKKFLSL EKDISDKDFL KYRRKKLEVI      1020
     LWVKIYMSVL EEEKNEELEK SKESFLNTCI DELKKEEYSE ENERMITIVD EMKKGFRICD      1080
     KVEDYKKKKW KNEEWYKDLK KEWIKEEDKY IDSIYLMKKD EIYEDDLLNK SIVELEKSVS      1140
     LKHWKDMYIK WIDEDNERDW LRIAIDKKNL KTDEINEDIN RMIELNMLED YSNDLYDKKK      1200
     IKWKTIIEIH MEVLNDCKND EWEMNKGDFL DICLEEFGTM ENKEYSHIIN NMLMVGELEY      1260
     KHLNMDVIER QNDLWNKWIE GHRYMLEKWK KEKWFIVLKE NWKNEEHKYM RKAYLELLMS      1320
     LREDVKNPLL QRQKIIWRKW IAKNLYHIES NVIKKWFDTL LEEIERKGVI ELDGCINLIE      1380
     MEENEEYLEY LKEYRKKKLI CIIWIKIYMM IIEEHKKEEY LECKEIFLDT CVDELREQEI      1440
     LEGNELYMDD MKTSILLNDQ KEEIEKLKMK KWYKDLKKEW IIEENRYFRS IINEEDDEEY      1500
     KNMISKPLRD VEKKISKKHW EDIQLKWIDE DNERDWLKIA RNENEEIKYL YINENVSKKK      1560
     KKVPFYIDDY RKKGRSNKNK IYRRKREKCN VKLNENNTMN KEMENWENRM EFLKICVDLL      1620
     KKRTFYYINI WEKNKAFYDE TNEIMKQLEE KIFERQKILW YNKEDMNKMS SKKWGNEEWF      1680
     IILKNDWNEE KTCYLNGIQY EYNINNLIEE EKKYLYLKKE KIIWKEWLLK NFKNIEECDN      1740
     EDWFNNLMET YKIDEICTIN MNGEIHSLGL ENTLKRNFLK NIIWIDIFMG VLNACEEEEE      1800
     LEEHKHKNML ESKVEDNDKL FYEKNEDYIN KNEMENYIND IQENEGNQMD IPDWFDAYQS      1860
     DEMSGKQKSI QKDEQWFIKE LEEGGIKSDV LQENYTIYNN KLIEQKMNIL RESYIRNQND      1920
     T                                                                      1921
//

If you have problems or comments...

PBIL Back to PBIL home page