(data stored in ACNUC9543 zone)

EMBL: AL844507.PE301

AL844507.PE301       Location/Qualifiers
FT   CDS             join(1333288..1333395,1333522..1336299)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831200"
FT                   /product="DnaJ protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831200"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.204:mRNA"
FT                   /db_xref="GOA:C0H4Z5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019111"
FT                   /db_xref="InterPro:IPR026894"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Z5"
FT                   /protein_id="CAX64170.1"
FT                   /translation="MFDYYKNKYKKGCLPYFLVIEIFSVIILGFIYVTFLDTRPYIGNS
FT                   FIATDFFDRWGRYLYATERFNEIFGIPSKDVLRSRSKIERYEEDDVILINRFVDEDEYN
FT                   AFLYIKKLMKDLKKYKLWNNYSVIPHVNEYNIVNKNEIDERIDNEIDTIKIFSKSNKNI
FT                   MYDLWFKVMNNEKMKYYSLINILKNTYKELKIIYKIPRNLRKRRRNKCKNIIYMYGDFM
FT                   ELMLNEMFEDWFNEGDFFLDEFKLLINSNRIAWKALMNHIQCTCKNIMTEGLEEVIRKK
FT                   NEKRSSNNIKKSSEKRKRRNRNENTKCAEKKNIDNYKEKVFLLKYNQYLSFNYKDSVDT
FT                   ELNMDEKEKRFKVKRRKHKKGKLRGTHMENENMKECMKQKEKNLNETLLNNPDLYKSES
FT                   NNIKSNNIKSNNIKSNNIKSNNIKSNNIKSNNIQSNNIKSNNIQSNIIQSNTIQSNNIQ
FT                   SNNIQSNNIQSRKSRNLEEAESIFSSETRFNNYNKKKVYYLDEEAHELFSNKNSKQKDN
FT                   NNDNAYGGCSRSRSSCVDTKYYDILNVKPYASFKEIKDSFYKLALKYHPDKNENNIEAK
FT                   IMFQKINEAYQILSDEDQRRKYDEGELNEVNDAFFMDPLIFFMMLFTSEELFDYIGTLR
FT                   IATFVSLVFKHNFFANGILTTKNIINKGIEKEQKKREVELAILLRERLQPYVDGNENWA
FT                   ENMENEIKKLFVSPFACSILESIGWTYENVSKRYIDEITNKWGIGLSFVNIKLAYRTVR
FT                   AVYSHVKSFFNIIFTVKKLKRAYEIMDSIIDGKDVHEPISNESNNMICDSECSCDYNVI
FT                   TPDNINKDSMSSNFNNNHSEHENNRKNVSEACSIISKKNNINDLNDNNSPITYEEKNKI
FT                   LKSFIIELLTVILYDIETTVRNASDKFLRDQGVDVYMRLKRAEGMCILGKLMQKWVKTK
FT                   KNDQDINKFDFINHTKNAFDKASCVDVDEDD"
     MFDYYKNKYK KGCLPYFLVI EIFSVIILGF IYVTFLDTRP YIGNSFIATD FFDRWGRYLY        60
     ATERFNEIFG IPSKDVLRSR SKIERYEEDD VILINRFVDE DEYNAFLYIK KLMKDLKKYK       120
     LWNNYSVIPH VNEYNIVNKN EIDERIDNEI DTIKIFSKSN KNIMYDLWFK VMNNEKMKYY       180
     SLINILKNTY KELKIIYKIP RNLRKRRRNK CKNIIYMYGD FMELMLNEMF EDWFNEGDFF       240
     LDEFKLLINS NRIAWKALMN HIQCTCKNIM TEGLEEVIRK KNEKRSSNNI KKSSEKRKRR       300
     NRNENTKCAE KKNIDNYKEK VFLLKYNQYL SFNYKDSVDT ELNMDEKEKR FKVKRRKHKK       360
     GKLRGTHMEN ENMKECMKQK EKNLNETLLN NPDLYKSESN NIKSNNIKSN NIKSNNIKSN       420
     NIKSNNIKSN NIQSNNIKSN NIQSNIIQSN TIQSNNIQSN NIQSNNIQSR KSRNLEEAES       480
     IFSSETRFNN YNKKKVYYLD EEAHELFSNK NSKQKDNNND NAYGGCSRSR SSCVDTKYYD       540
     ILNVKPYASF KEIKDSFYKL ALKYHPDKNE NNIEAKIMFQ KINEAYQILS DEDQRRKYDE       600
     GELNEVNDAF FMDPLIFFMM LFTSEELFDY IGTLRIATFV SLVFKHNFFA NGILTTKNII       660
     NKGIEKEQKK REVELAILLR ERLQPYVDGN ENWAENMENE IKKLFVSPFA CSILESIGWT       720
     YENVSKRYID EITNKWGIGL SFVNIKLAYR TVRAVYSHVK SFFNIIFTVK KLKRAYEIMD       780
     SIIDGKDVHE PISNESNNMI CDSECSCDYN VITPDNINKD SMSSNFNNNH SEHENNRKNV       840
     SEACSIISKK NNINDLNDNN SPITYEEKNK ILKSFIIELL TVILYDIETT VRNASDKFLR       900
     DQGVDVYMRL KRAEGMCILG KLMQKWVKTK KNDQDINKFD FINHTKNAFD KASCVDVDED       960
     D                                                                       961
//

If you have problems or comments...

PBIL Back to PBIL home page