(data stored in ACNUC9543 zone)

EMBL: AL844507.PE302

AL844507.PE302       Location/Qualifiers
FT   CDS             join(1339659..1339742,1339925..1342306)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831300"
FT                   /product="Plasmodium exported protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.205:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Z6"
FT                   /protein_id="CAX64171.1"
FT                   /translation="MEYIHILRKLLFSYFSVVLLGIIYEIPVDLSVYDETEQSGVKYLN
FT                   ICSRKLSETEKDHIPSLRCHELKYKSKDEINEESCINREDFKEFDIKDENEEVKMDEYE
FT                   NDEEETYEEEEEYIDEKNENYENKEDISDREDLSDMENNNDKDDLSDMENNNDKDDLSD
FT                   MENNNDKDDLSDMENNNDKEDLSDKEDLSDKEDLSDKEDLSDREDLSDKEDLSDKEDLS
FT                   DKEDLSDKEDLSDREDLCDKENLSDKEDLSDMEYSNDKDDFSDMEYSNDKDDFSDKEDI
FT                   NDREDFSDKENSYNEEYNNNGEEENFKREKYDKTIINNLYYSKWNVGVENDENKWIDEN
FT                   HELMDKWSLIKNCTNGKWIDCEKIHDEYRKKKNYDDSMWENIKQDDEVDEWDLGHEKEK
FT                   DKWVFVEGYDYTNSVIEEENDDELKNIESDDEQKWDFSEDEEDKSDSVEERNDVEHQKK
FT                   IEEEKDDENSNSGKWDFIRNKENGWGILENQKERMNFSEKDENRINLIELYFDNVYNYV
FT                   DRKYENEDLISSEPEKVNVMKQEEEYNKNDDIDMNKYSKKDIGMFYLYQEELKNEGDKE
FT                   ELINKRDNKRNKENDEDITIENDEQILNGNYEKEGKSKELKGENDCINESSENIIKKKT
FT                   DKKEDINNNNNTTENNENIDYNKFIKDLKEDKVDNVFHGFGSYPLKKDILGLWWEALSI
FT                   IKLGFEIITRDFKSYMKTYLDKYEYNHRSTYEYPFIWSYIQSTWGRCILNLGMEVASEQ
FT                   KEFSRNFYHLLNKTANLEDITNFIYSGMMYFEKLRKRLLYKYKHTFRSKIKNLPDNALN
FT                   IKFYQGKLI"
     MEYIHILRKL LFSYFSVVLL GIIYEIPVDL SVYDETEQSG VKYLNICSRK LSETEKDHIP        60
     SLRCHELKYK SKDEINEESC INREDFKEFD IKDENEEVKM DEYENDEEET YEEEEEYIDE       120
     KNENYENKED ISDREDLSDM ENNNDKDDLS DMENNNDKDD LSDMENNNDK DDLSDMENNN       180
     DKEDLSDKED LSDKEDLSDK EDLSDREDLS DKEDLSDKED LSDKEDLSDK EDLSDREDLC       240
     DKENLSDKED LSDMEYSNDK DDFSDMEYSN DKDDFSDKED INDREDFSDK ENSYNEEYNN       300
     NGEEENFKRE KYDKTIINNL YYSKWNVGVE NDENKWIDEN HELMDKWSLI KNCTNGKWID       360
     CEKIHDEYRK KKNYDDSMWE NIKQDDEVDE WDLGHEKEKD KWVFVEGYDY TNSVIEEEND       420
     DELKNIESDD EQKWDFSEDE EDKSDSVEER NDVEHQKKIE EEKDDENSNS GKWDFIRNKE       480
     NGWGILENQK ERMNFSEKDE NRINLIELYF DNVYNYVDRK YENEDLISSE PEKVNVMKQE       540
     EEYNKNDDID MNKYSKKDIG MFYLYQEELK NEGDKEELIN KRDNKRNKEN DEDITIENDE       600
     QILNGNYEKE GKSKELKGEN DCINESSENI IKKKTDKKED INNNNNTTEN NENIDYNKFI       660
     KDLKEDKVDN VFHGFGSYPL KKDILGLWWE ALSIIKLGFE IITRDFKSYM KTYLDKYEYN       720
     HRSTYEYPFI WSYIQSTWGR CILNLGMEVA SEQKEFSRNF YHLLNKTANL EDITNFIYSG       780
     MMYFEKLRKR LLYKYKHTFR SKIKNLPDNA LNIKFYQGKL I                           821
//

If you have problems or comments...

PBIL Back to PBIL home page