(data stored in SCRATCH zone)

EMBL: AL844507.PE303

AL844507.PE303       Location/Qualifiers
FT   CDS             complement(join(1344405..1345241,1345416..1345487))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831400"
FT                   /product="Plasmodium exported protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.206:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4Z7"
FT                   /protein_id="CAX64172.1"
FT                   /translation="MMRILYTNVFLFIAVLFCILSPGNNPLHKYVEIKEGINNLSIHAH
FT                   LRLLTEIMENCSLNGFRLNDKNGEHDEEEERKCDDDQHSENQEHECDNDQHSENQEHEC
FT                   DNEQNDESKCEESNNTDQADVNYLSMPIQIPYLRNEIMDDNYYSRYFDSNIMRTDEVTT
FT                   RLNDQNLIEKCLCKLKAGKYINEAKIKYAHEIIDSMKLTDKVKDIFKEFMRYYIWKRYP
FT                   SHQLRLYKKIKKDIEKYTRNHVICSLIDFETIEDELYYLIYPNREMYMSFDTAVNTKRR
FT                   KKIKKLMREKARKDKEKNGYI"
     MMRILYTNVF LFIAVLFCIL SPGNNPLHKY VEIKEGINNL SIHAHLRLLT EIMENCSLNG        60
     FRLNDKNGEH DEEEERKCDD DQHSENQEHE CDNDQHSENQ EHECDNEQND ESKCEESNNT       120
     DQADVNYLSM PIQIPYLRNE IMDDNYYSRY FDSNIMRTDE VTTRLNDQNL IEKCLCKLKA       180
     GKYINEAKIK YAHEIIDSMK LTDKVKDIFK EFMRYYIWKR YPSHQLRLYK KIKKDIEKYT       240
     RNHVICSLID FETIEDELYY LIYPNREMYM SFDTAVNTKR RKKIKKLMRE KARKDKEKNG       300
     YI                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page