(data stored in SCRATCH zone)

EMBL: AL844507.PE304

AL844507.PE304       Location/Qualifiers
FT   CDS             join(1353456..1353650,1353857..1354669)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831500"
FT                   /product="Plasmodium exported protein (PHIST), unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831500"
FT                   /db_xref="InterPro:IPR006526"
FT                   /db_xref="InterPro:IPR019111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZW02"
FT                   /protein_id="CZT62757.1"
FT                   /translation="MSLFTKFNSQDYKNGITKNLSNTEQNNIININNGYKKKTSWNCLG
FT                   SFRNICLTLCVITALYIQFKNKYGENSSCVVQLDKISSRNLSDVQVENFPSLNHGDKTY
FT                   KKNDEKDESNNENSNINKQADEDNEEVSQNNNNSNNNSKNNNSNNNVNNNISNVSNDSG
FT                   NVVGKKIKKKTYLNYNDMTKQLTKEELFYVLDSLKKVPGRRNLNNIWKHALGVISDILD
FT                   EKLIDLNVYIQKYKKKYESKRDEQSYRISKSGLMEKYLDEFDERIMEQRMTYSSNFKHL
FT                   IHKSPSLDDIKNFIHTFIDDLEKLINYMYGSYKHIFQLVNEEPSKASFNDFIFK"
     MSLFTKFNSQ DYKNGITKNL SNTEQNNIIN INNGYKKKTS WNCLGSFRNI CLTLCVITAL        60
     YIQFKNKYGE NSSCVVQLDK ISSRNLSDVQ VENFPSLNHG DKTYKKNDEK DESNNENSNI       120
     NKQADEDNEE VSQNNNNSNN NSKNNNSNNN VNNNISNVSN DSGNVVGKKI KKKTYLNYND       180
     MTKQLTKEEL FYVLDSLKKV PGRRNLNNIW KHALGVISDI LDEKLIDLNV YIQKYKKKYE       240
     SKRDEQSYRI SKSGLMEKYL DEFDERIMEQ RMTYSSNFKH LIHKSPSLDD IKNFIHTFID       300
     DLEKLINYMY GSYKHIFQLV NEEPSKASFN DFIFK                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page