(data stored in ACNUC9543 zone)

EMBL: AL844507.PE305

AL844507.PE305       Location/Qualifiers
FT   CDS             join(1358314..1359142,1359287..1359859,1360002..1360055,
FT                   1360151..1360213,1360362..1360493,1360628..1360813,
FT                   1360942..1361100,1361249..1362015,1362197..1363618)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831600"
FT                   /product="cytoadherence linked asexual protein 8"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831600"
FT                   /db_xref="GOA:A0A143ZVM1"
FT                   /db_xref="InterPro:IPR005553"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZVM1"
FT                   /protein_id="CZT62758.1"
FT                   /translation="MISYFKVVVFIIFFFLFLKRRVICSINESKNVNENLNGDSNPNDN
FT                   INQLKSMIGNDELHKNLTILEKLILDSLENDKLKSPLVKQETDKYLDLSKFKKKSINDA
FT                   DDDIYIVPTIQSSFYDIAKYENLLKEQSIESYNANISDLIKKKLLIVRTLKTIKLMLIP
FT                   LNSYKEKNNLKIALEELNKVFKNNINQSEKKRLLNSHSETFRNILNVVDEVNKSNEIIN
FT                   KGEAIILGDTKIDLMSTNDFFFTTNSNIKFMEELDNISNQYGLGLITQLGPHLIALGHF
FT                   MILKLALKYYDIYFELKTVKFFSWQKILQFNMSDRYKILDILCFQNAVYYSEKKRRKTY
FT                   MKVDRSNTNMECNILEFLIHFFNKYQLEIIKITEDTDFDLHGMMEHKHIKDGFFSYICN
FT                   DPKECIIYHTNRFKKEKDEEDTFEVQDTSHNISAYNLYLNYYYFMKRYSSYGMKKTTYV
FT                   HLLNLTGLLNYDTRAYVTSLHLPGYYNTIEMSFTEETELPTLFDHSLECIRKCYLDERY
FT                   EYTSFMKHIPLDSNFMNEVSKCNLCKGAFLYANLKFDNVPSMLQKFYIYVTQGLKLQKV
FT                   TSLVRTLDIYQDYSNFLSHDVNWYTFLFLFRITSFQKIAQKNVVESLYLNLKDEDSFHR
FT                   TVTTCYWFPSPIKKYYTLYVRKHLPNNLLDELLRQMRKSTIEKMKKSITFLVHVNSFLQ
FT                   LDFFHNLNEAPFGLPRAHPLSLILEHKFKEWIDSSPAGFYFSNYQNPYIRRELHNRVLD
FT                   LKFEPPKINEWNKVLKRIIESAYEMYFEQRHVKSLFKYHNIYNINNKIMLMRDAYDIFR
FT                   KNVDDILFFADIINIRKYLTATPLVKKGMDRIFYVIHNILGNSVNYYKYGIIYGFKVNK
FT                   EILKEVVDELFSIYNFNTDIFTDISFLQTVYLLFRKIEDTYKTQRRNDRMSINNIFFMN
FT                   VANNYSKLNMEQRELEIHNSMASRFYSKTMFSAFQMLFSTMLSNEANHLDKVYGKSGKI
FT                   GLATSVTAYLTFAYVYNGSIMDSITNSLLPPYAKKPITQLKYGRTFVFSNYFMLASKMY
FT                   EMLNYKNLSLLCEYQAVVSANYYSSKKVDQFLGRKFFPLTTTFLIKRISTSIDHISGGK
FT                   WYNLFGCLGKDPPAYLYFHFFLNLYFDSGKYFPGGFSTSLREQTEHVKKKGFPKKPSVH
FT                   GFTQMVFLQLTNIVMYALCFMSLSQIYAYFENVNFYIISNFRFLERYFNIFNKYFVELF
FT                   RRKLKEYTSDVLLKYEYETYINIRKRGYLDEAMEARITAKNNVKEYLYDNDENVMINLR
FT                   RYAMENMHKINLSTYVDDYIYFDDCGKNEEFLNDRCDICPVYEESDEDDQKALSSNSKA
FT                   ITQIKSKTTTYIDYKKFPKEVSTKISEEENSDDDMNLTDNALMITKIPEDE"
     MISYFKVVVF IIFFFLFLKR RVICSINESK NVNENLNGDS NPNDNINQLK SMIGNDELHK        60
     NLTILEKLIL DSLENDKLKS PLVKQETDKY LDLSKFKKKS INDADDDIYI VPTIQSSFYD       120
     IAKYENLLKE QSIESYNANI SDLIKKKLLI VRTLKTIKLM LIPLNSYKEK NNLKIALEEL       180
     NKVFKNNINQ SEKKRLLNSH SETFRNILNV VDEVNKSNEI INKGEAIILG DTKIDLMSTN       240
     DFFFTTNSNI KFMEELDNIS NQYGLGLITQ LGPHLIALGH FMILKLALKY YDIYFELKTV       300
     KFFSWQKILQ FNMSDRYKIL DILCFQNAVY YSEKKRRKTY MKVDRSNTNM ECNILEFLIH       360
     FFNKYQLEII KITEDTDFDL HGMMEHKHIK DGFFSYICND PKECIIYHTN RFKKEKDEED       420
     TFEVQDTSHN ISAYNLYLNY YYFMKRYSSY GMKKTTYVHL LNLTGLLNYD TRAYVTSLHL       480
     PGYYNTIEMS FTEETELPTL FDHSLECIRK CYLDERYEYT SFMKHIPLDS NFMNEVSKCN       540
     LCKGAFLYAN LKFDNVPSML QKFYIYVTQG LKLQKVTSLV RTLDIYQDYS NFLSHDVNWY       600
     TFLFLFRITS FQKIAQKNVV ESLYLNLKDE DSFHRTVTTC YWFPSPIKKY YTLYVRKHLP       660
     NNLLDELLRQ MRKSTIEKMK KSITFLVHVN SFLQLDFFHN LNEAPFGLPR AHPLSLILEH       720
     KFKEWIDSSP AGFYFSNYQN PYIRRELHNR VLDLKFEPPK INEWNKVLKR IIESAYEMYF       780
     EQRHVKSLFK YHNIYNINNK IMLMRDAYDI FRKNVDDILF FADIINIRKY LTATPLVKKG       840
     MDRIFYVIHN ILGNSVNYYK YGIIYGFKVN KEILKEVVDE LFSIYNFNTD IFTDISFLQT       900
     VYLLFRKIED TYKTQRRNDR MSINNIFFMN VANNYSKLNM EQRELEIHNS MASRFYSKTM       960
     FSAFQMLFST MLSNEANHLD KVYGKSGKIG LATSVTAYLT FAYVYNGSIM DSITNSLLPP      1020
     YAKKPITQLK YGRTFVFSNY FMLASKMYEM LNYKNLSLLC EYQAVVSANY YSSKKVDQFL      1080
     GRKFFPLTTT FLIKRISTSI DHISGGKWYN LFGCLGKDPP AYLYFHFFLN LYFDSGKYFP      1140
     GGFSTSLREQ TEHVKKKGFP KKPSVHGFTQ MVFLQLTNIV MYALCFMSLS QIYAYFENVN      1200
     FYIISNFRFL ERYFNIFNKY FVELFRRKLK EYTSDVLLKY EYETYINIRK RGYLDEAMEA      1260
     RITAKNNVKE YLYDNDENVM INLRRYAMEN MHKINLSTYV DDYIYFDDCG KNEEFLNDRC      1320
     DICPVYEESD EDDQKALSSN SKAITQIKSK TTTYIDYKKF PKEVSTKISE EENSDDDMNL      1380
     TDNALMITKI PEDE                                                        1394
//

If you have problems or comments...

PBIL Back to PBIL home page