(data stored in ACNUC9543 zone)

EMBL: AL844507.PE306

AL844507.PE306       Location/Qualifiers
FT   CDS             complement(1365467..1367506)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0831700"
FT                   /product="heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0831700"
FT                   /db_xref="GOA:K7NTP5"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:K7NTP5"
FT                   /protein_id="CZT62759.1"
FT                   /translation="MKTKICSYIHYIVLFLIATTTVHTASNNAEESEVAIGIDLGTTYS
FT                   CVGICRNGVVDIIANDQGNRTTPSYVAFTDTERLIGDAAKNQASRNPENTVFDAKRLIG
FT                   RKFSETTVQSDMKHWPFTVKGGSDGKPMIEVSYQGEKKTFHPEEISSMVLKKMKEVAET
FT                   YLGKPVKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAAIAYGLDKKGKGE
FT                   QNILIFDLGGGTFDVSLLTLEDGIFEVKATSGDTHLGGEDFDNKLVNFCVQDFKKKNGG
FT                   KDVSKNSKSLRRLRTQCEKAKRVLSSSAQATIEVDSLFDGIDYNVNITRAKFEELCMDQ
FT                   FRNTLIPVEKVLKDAKMDKSQVHEIVLVGGSTRIPKIQQLIKDFFNGKEPCKAINPDEA
FT                   VAYGAAVQAAILSGDQSSAVKDLLLLDVCPLSLGLETAGGVMTKLIERNTTIPTKKNQI
FT                   FTTYADNQPGVLIQVYEGERAMTKDNNLLGKFQLEGIPPAPRSVPQIEVTFDIDANGIL
FT                   NVTALDKGTGKQNQITITNDKGRLSKDDIDRMVNDAEKYKEEDEQNKNRIEARNNLENY
FT                   CYNVKNTLQDENLKTKIPKDDSEKCMKTVKSVLDWLEKNQTAETEEYNEKEKDISSVYN
FT                   PIMTKIYQGASAQEPQKAEATNLRGRNSENKEAQNNGPTVEEVN"
     MKTKICSYIH YIVLFLIATT TVHTASNNAE ESEVAIGIDL GTTYSCVGIC RNGVVDIIAN        60
     DQGNRTTPSY VAFTDTERLI GDAAKNQASR NPENTVFDAK RLIGRKFSET TVQSDMKHWP       120
     FTVKGGSDGK PMIEVSYQGE KKTFHPEEIS SMVLKKMKEV AETYLGKPVK NAVITVPAYF       180
     NDSQRQATKD AGAIAGLNVL RIINEPTAAA IAYGLDKKGK GEQNILIFDL GGGTFDVSLL       240
     TLEDGIFEVK ATSGDTHLGG EDFDNKLVNF CVQDFKKKNG GKDVSKNSKS LRRLRTQCEK       300
     AKRVLSSSAQ ATIEVDSLFD GIDYNVNITR AKFEELCMDQ FRNTLIPVEK VLKDAKMDKS       360
     QVHEIVLVGG STRIPKIQQL IKDFFNGKEP CKAINPDEAV AYGAAVQAAI LSGDQSSAVK       420
     DLLLLDVCPL SLGLETAGGV MTKLIERNTT IPTKKNQIFT TYADNQPGVL IQVYEGERAM       480
     TKDNNLLGKF QLEGIPPAPR SVPQIEVTFD IDANGILNVT ALDKGTGKQN QITITNDKGR       540
     LSKDDIDRMV NDAEKYKEED EQNKNRIEAR NNLENYCYNV KNTLQDENLK TKIPKDDSEK       600
     CMKTVKSVLD WLEKNQTAET EEYNEKEKDI SSVYNPIMTK IYQGASAQEP QKAEATNLRG       660
     RNSENKEAQN NGPTVEEVN                                                    679
//

If you have problems or comments...

PBIL Back to PBIL home page